KEGG   Turneriella parva: Turpa_1959Help
Entry
Turpa_1959        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12606
UniProt: I4B5P9
Position
complement(1995399..1996175)
Genome map
AA seq 258 aa AA seqDB search
MSQPAKTMGLKASFIAPLICCAVLLLSACSPKPPQITYIGPLDRVQEGFLDPVTYQIVSF
GLALDFSKPLDPKAHFFPPVIDENFDNEEFLKYSGEQQTLIKARKPHNGYPLADILAAEA
NQLNPQEINLSLIDEKIRAPMEIKRVLFDNACTNARIMGLYRWLIGDAVQMRLLHGATIP
REGIQKTTLDPRYYPPREFYVAESAAILKNLDQAMAKRGYRYEIVHEAFSKPEQLECKMA
IHIHKKNLQIGLPFLAPL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcctgccaaaacgatgggcctcaaagcttctttcatcgcaccgctcatttgt
tgcgctgttttgctgctttcggcctgtagcccgaagccaccgcaaatcacgtacatcggt
ccgcttgatcgggtgcaagagggctttcttgatccggtgacgtaccagattgtctcattt
ggcctcgcgctcgacttctcgaagcctctcgaccccaaggcgcacttttttcccccggtg
atcgacgagaattttgacaatgaagagttcttgaagtacagcggtgaacagcagaccctc
atcaaggcgcgcaaaccgcacaatgggtacccactggcagatattctggcggctgaggcg
aatcaactcaacccgcaagagataaacctctcgctaatcgatgaaaaaattcgcgcgcct
atggagatcaagcgcgtacttttcgacaatgcctgcacgaatgcgcgcatcatgggtctc
taccgctggctgatcggtgacgcagtgcagatgcggctgctgcacggcgccacgataccc
cgcgaaggcattcaaaagacaacgctcgacccgcgttattacccgccgcgcgagttttat
gtcgcagaatcggcggcgattctgaaaaacctcgaccaggccatggcaaagcgtggttac
cgctacgaaattgtgcacgaagccttttcaaagcccgagcaactcgaatgtaaaatggcg
atccacattcacaaaaagaatctgcagatcggcctgccgtttctcgcccctctataa

DBGET integrated database retrieval system