KEGG   Turneriella parva: Turpa_1968Help
Entry
Turpa_1968        CDS       T02157                                 

Definition
(GenBank) peptidase U62 modulator of DNA gyrase
  KO
K03568  
TldD protein
Organism
tpx  Turneriella parva
Brite
Peptidases [BR:tpx01002]
 Peptidases of Unknown Catalytic Type
  Family U62
   Turpa_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2004685..2006067
Genome map
AA seq 460 aa AA seqDB search
MNADVTRAKIESALAPLHERYAFARALFIETSGLSVSSNLNQTFVEPLSAQRGIVVSILH
NGLIYEASSVVHSVSDISKTIEGLERTVRASKLKGTLALHAEAPATLSAGGPSPDELSEA
DKAKFAARIAREIKARKPLVAMASARYKQTNTREIYVSREKSLEQYLPRFEAIYSAVLKD
DTTNSTAQIYDGFSRRGSWNLMGENLELIDGMLHDGEKILGAPRLEPGQYECIFSPSLSG
MLAHEAFGHGTEADTMQKGRARGTEYLGKAVAAPGVRLYDSPLLETAAASYYFDHEGMPA
SETRIVEGGVLNQPMTDHASASRLGYPRSPNGRRESFDHKIYSRMTNTYFMPGEDSLDAM
IASVADGYFVDRATNGMEDPKSWGIQLEALVARRIRHGKLTDEYFSPVIVTGYVPEILQS
ISMISRDLHINGLGMCGKGYKEWVKVTDGGPYLKLRARLA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagacgtcacacgtgcgaagattgaatcggcgttagcgccattgcatgagcga
tatgcgtttgcgcgggccctttttatagaaacctcggggctgagcgtcagcagcaatctg
aaccagacctttgttgaaccactgtctgcccagcgcggtatcgtcgtgagtattttgcac
aacggcctcatctatgaagcctcatcggttgtgcacagtgtttcagacattagcaaaacg
atcgaagggttagagcgaacagtcagggcaagtaagctcaagggcacgttggcgttgcat
gccgaagcgccggctaccctgagcgcgggtgggccatcgcccgatgaactgagcgaggca
gacaaagccaaattcgctgcgcgcatcgcacgcgaaatcaaggcgcgtaaacctctcgtc
gcaatggcatcggcgcgatacaaacagacgaacacccgcgaaatttacgtgagccgtgaa
aaatcactcgagcaatacctgccgcgctttgaggcaatctactccgctgtactgaaagac
gataccacgaactcaaccgctcagatttatgatgggttcagccgtcggggttcgtggaac
ctcatgggtgaaaatctcgaactgatcgacggcatgctgcacgatggtgaaaaaattctc
ggcgcaccccgcctcgaaccgggccaatacgagtgtatcttctcgccgtcgctttcgggc
atgctcgcgcacgaggcgttcgggcatggcaccgaagccgataccatgcaaaaaggcagg
gcgcgcggcacagaatatctcggcaaggcagttgcagcaccgggtgtgcgtctctatgat
tctccgctgctcgaaacggctgcagccagctattatttcgatcacgagggcatgcctgct
tctgaaacgcgcatcgtcgaagggggagttctcaatcagccgatgaccgaccacgcaagc
gcatcgcggctcggctacccaaggtcacccaatggccgccgcgaaagcttcgatcataag
atttattctcgcatgacgaacacctactttatgcccggcgaagattcgctcgatgcgatg
atcgcttcggttgccgacggctatttcgtcgatcgtgccacgaacggtatggaagacccg
aaaagctggggtattcagctcgaagcgcttgtcgcgcgccgaattcgtcacggcaaactg
acagacgagtatttctcgcccgtaattgttacgggttatgtacctgaaattctgcaatcc
atctccatgatctcgcgagacctgcacatcaacggcctcggtatgtgcggcaaaggttac
aaagaatgggtcaaggtcaccgatggtggcccttatttgaaattacgcgcccggctcgcc
tga

DBGET integrated database retrieval system