KEGG   Turneriella parva: Turpa_1970Help
Entry
Turpa_1970        CDS       T02157                                 

Definition
(GenBank) 23S rRNA m(2)A-2503 methyltransferase
  KO
K06941  
23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
tpx  Turneriella parva
Brite
Enzymes [BR:tpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     Turpa_1970
Ribosome biogenesis [BR:tpx03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Turpa_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2007381..2008430)
Genome map
AA seq 349 aa AA seqDB search
MAIETKPEILSLTEAELTELLVADGHKKFRAQQVFQWLHLKQVFDPAKMTNLKPEFHDYL
RARFTLPEFKILNETRSPSDQTAKYLFEFGNRQVESVWLPYENRQSICISVQSGCSLDCS
FCATGKIAFKGNLTAGQILSQVYGMQQLYDRRISNVVFMGMGEPFYNYDNAIRAASLIAD
QHGMNISRRRITLSTSGVLPGIKRFIEEKQPYRLALSLHAVFADKRRQIMDIEEKFSFEE
VLEYLLQKRNDLQQGQLMFEYIMIDGVNIFPDDAKELARWAKLLKAKVNLIPMNTSFNGM
HRPSDDKIIEFWQALVSRGIVAVNRKSPAKDIDGACGMLAGRQENTLKV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcgaaacaaaacctgaaattctttcgctgacagaagcagagttaactgaactt
cttgttgccgacggccacaagaagttcagggcccaacaggtgtttcagtggctgcacctg
aagcaggtattcgacccggcgaagatgacgaacctgaaacccgagtttcatgactacctc
agggcaagattcacactgccagaattcaagattctgaacgagactagatccccctctgac
cagactgccaaatacctgttcgaatttggtaaccgccaggtcgagagtgtctggctgccc
tatgaaaaccgccaatcgatctgcatttcggtgcagtcgggttgctcgctcgattgcagc
ttctgcgccacgggcaagattgcgttcaagggcaacctgaccgccgggcagattctgtcg
caggtttatggcatgcaacagctctacgaccggcgcatcagcaacgtggtcttcatgggc
atgggcgaaccgttctataattatgacaacgcgatcagggcagcgagcctcatcgccgac
cagcacggcatgaacatctcgcgccgccgcattaccctcagtacctcgggggtattaccc
ggaatcaaacgtttcatcgaagaaaaacaaccttaccggctcgcactttcgctgcacgcg
gtatttgccgacaagcgccgccagattatggatatcgaagagaaattttcattcgaagag
gttctcgaatatctgttgcaaaagcgaaacgacctgcaacagggtcagctgatgttcgaa
tatatcatgatcgacggggtcaatatattccctgacgatgccaaagagctggcgcgttgg
gcgaagctcttgaaggcgaaagtcaacctgataccgatgaacacatcattcaacggcatg
caccgcccctctgacgataagataattgaattctggcaggcgcttgtgtcgcgcggtata
gttgcggtgaaccgcaaatcgcccgcaaaagacatcgacggcgcctgcggcatgcttgcg
ggcaggcaagagaacacgcttaaagtttag

DBGET integrated database retrieval system