KEGG   Turneriella parva: Turpa_1977Help
Entry
Turpa_1977        CDS       T02157                                 

Definition
(GenBank) bacterial peptide chain release factor 2 (bRF-2)
  KO
K02836  peptide chain release factor 2
Organism
tpx  Turneriella parva
Brite
Translation factors [BR:tpx03012]
 Prokaryotic Type
  Release factors
   Turpa_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1 ABC_tran_CTD
Motif
Other DBs
NCBI-ProteinID: AFM12624
UniProt: I4B5R7
Position
complement(2015283..2016401)
Genome map
AA seq 372 aa AA seqDB search
MAQSLKEVKGSLAALRDQIDARYTELNLKDVEAELGDLNKKMEDPRLFADDSRVGEVREL
QTRIAVLERKISSWKALKAEIADALEYAEIAEMENAENMAAELEQRGTDARATFDKLDLE
SLLTGPDDMNNAFVNIHPGAGGTESQDWADMLTRAYMRYGEKAGFNVELIDYQEGEEAGI
KNATILVSGPNAYGYLKAENGIHRLVRISPFDSNKRRHTSFAAVHVSPEISDDVEIEVLE
KDLRIDVYRASGAGGQHVNKTESAVRMTHLPTGVVVSSQTQRSQIQNRLTCMKMLKARLY
EMARAEKEAEIESRSGERKDISWGNQIRSYVFHPYSMVKDLRTGEETSQVQNVMDGDFGP
FIDAFLRNKKRN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagtcgttaaaagaagtcaaagggtctcttgccgcgctgcgcgaccagatcgac
gcgcgttacacagagctcaacctcaaagatgtcgaagccgaactcggcgacctgaacaaa
aagatggaagacccgcgcctctttgccgatgacagccgcgtgggcgaagtgcgcgaatta
cagacgcgcattgcggtgctcgagcgcaaaatcagctcgtggaaagcgctgaaagccgag
atcgccgacgcgctcgaatacgctgaaattgccgagatggaaaacgccgaaaacatggcg
gccgaactcgagcagcgcggcaccgacgcgcgcgcgacctttgacaaactcgatctcgaa
agcctgctcaccggccccgacgatatgaacaacgcgttcgtcaacattcaccccggcgcc
ggtggcaccgagtcgcaagactgggccgacatgctgacgcgcgcctacatgcgctatggc
gaaaaagccgggttcaatgtcgaactcattgactatcaagaaggcgaagaagcgggcatc
aagaatgcgacgattctggtgagcggcccgaacgcatacggatatctcaaggctgaaaac
ggaattcaccggttggtgcgcatttcgccgttcgattcaaacaagagacggcacacctcg
ttcgcggccgtgcacgtttcgcccgaaatctctgacgacgtcgagattgaagttctggag
aaagacctgcgtatcgatgtataccgcgcgagcggcgcaggcggccagcacgttaacaaa
acagaatccgctgtgcgcatgacgcatctaccgaccggcgtcgtcgtttcaagccagacg
cagcgcagccagattcagaaccggctgacgtgcatgaagatgctcaaggcccgcctgtac
gaaatggcgcgcgctgaaaaagaagccgaaattgaatcgcggtcgggcgaacgcaaagat
atctcatggggcaaccagattcgcagttatgtctttcacccttatagcatggtcaaagac
ctgcgcaccggcgaagagacctcgcaggtgcagaatgtgatggatggcgactttggcccg
tttatcgacgccttcttgcgcaataaaaaaagaaactaa

DBGET integrated database retrieval system