KEGG   Turneriella parva: Turpa_1978Help
Entry
Turpa_1978        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2016505..2017341
Genome map
AA seq 278 aa AA seqDB search
MPLSDGKLIGKYRRLLIQHEDLPAEAARLAPQLTRLGDLYASGKLSDAEYTFWFVLLFTH
ERCRHLRPSRAQTNLAAKLEWLHNEDSPPPRAQSAIANLNAFGMPGMVWQVLGDWLHGRL
SADKSTGSPLRLSQAPHSPRDMLATQATGARIVTVDFAAAIAGKPVGSTRDAFEFVLHDL
GHAYAFYLPEYDPGGQVRFFHLLQNDLPHLQNLAQTDTKFEADLEYCMADMNTHPEHLRQ
YLRGVIIEAFYRLRQGDTAGLFSEEALGRFLASLGAVV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccgctaagcgacggtaaactgatcggcaaataccggcggctgctcattcagcacgaa
gacctgcccgcagaggcggcgcggcttgcaccgcagctcacgcgcctcggcgacctgtac
gcatcgggtaagctcagcgacgccgaatatactttttggtttgtgctgctcttcacccat
gagcgctgccgccacctcaggccatcacgagcacaaaccaatctggcggctaaactagaa
tggttgcataatgaggattcaccacccccacgagcccagagcgcgatagcaaacctgaac
gcctttggtatgccgggcatggtctggcaggtactcggcgactggctgcacggccgctta
tccgcagataaatcaacaggctcgcctctgcggctcagccaggccccgcatagtccgaga
gatatgctcgcgactcaggcgaccggtgcgcgcatcgtcacggtcgatttcgccgcagcg
atcgccggtaagccagtcggttcgacgcgcgacgcgttcgagtttgtgctgcacgacctc
ggccacgcttacgctttttacctgccagaatacgatcccggggggcaggtacgtttcttt
cacttgctccagaacgacttgccccacctgcagaatctggcgcagaccgataccaaattc
gaggccgacctcgaatactgtatggccgacatgaatacgcaccccgaacacctgcgccaa
tacctgcggggtgtcatcatcgaggcgttctaccggttgcggcaaggcgatacggcgggc
ctgtttagcgaagaggcgctgggccgcttcctggcgagtcttggggcggtggtgtag

DBGET integrated database retrieval system