KEGG   Turneriella parva: Turpa_1983Help
Entry
Turpa_1983        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12630
UniProt: I4B5S3
Position
complement(2021362..2022039)
Genome map
AA seq 225 aa AA seqDB search
MRVTFLFLLLLHVPLYACPDAGEAANAWAQENFGGDEENPLVVQKRVTRLNPMVSAVQIT
LPADPDDQEAGPKIVTAFFTGANCEFAQQFDGEIADSIEVGATKYLFIRTEVVDAEERQV
NYQPVTVQSSGEIGYTRDQHGSEIQFAQSLQQRCEGNVGQMATWQRDKNDNRLLIVTERQ
SDRDEKCRLIQDSSTFRYYRLTDDIWRLDDGDSEAETTTTAKRKP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgacctttttgtttctattgctgctgcacgtaccgctctatgcatgccccgat
gccggtgaggctgcaaacgcctgggcacaggaaaactttggtggtgacgaagaaaatcca
ctcgtggtacagaagcgcgttacccgtctgaacccgatggtctctgcggtgcaaatcact
ttaccggccgaccccgatgatcaagaggccggcccgaaaattgttacagctttctttacc
ggggcaaactgtgaattcgcacagcaatttgatggcgaaattgccgattccattgaagtg
ggggcgacaaaatatctgttcataagaactgaggtggttgatgcagaagagagacaggtc
aattaccagccagttaccgtgcagtcatcgggagaaatcggctatacgcgtgaccaacat
ggttcagaaattcaattcgcgcaatctttgcagcagcgctgcgaaggtaatgtcggtcaa
atggcgacctggcagcgcgacaagaacgacaaccgcctgctgatcgtcacggagcggcag
agtgaccgcgacgaaaaatgccggctgattcaagactcttcgacttttcggtattaccgg
ctgacagacgacatctggcgcctcgatgacggcgacagcgaagctgagaccacaacaact
gcaaagcgaaagccttaa

DBGET integrated database retrieval system