KEGG   Turneriella parva: Turpa_1985Help
Entry
Turpa_1985        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2023814..2024368
Genome map
AA seq 184 aa AA seqDB search
MPAQRHRHLRFITLRLEILIVAFTFTSGTFAAERRAAVSFAPGFLTAQGAVAYGVGAEAE
WYGRAGVSVRGDLYALLGASKSLALQQIYQAMLGIAYNFERSGPLAPFVGFQPGFGFASV
RNGIADGLYLYPVMSPLFGAHLFASEGWQVSGHVRYVFGEMNYAETGAVYLSEFRAGVSL
GQTF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccggcacagcgacataggcacttacggttcataacgctgaggttagaaatcctcatc
gttgccttcactttcacctcaggcacgttcgccgcagaacgtcgggctgccgtgagcttc
gcgccgggatttctgaccgctcagggggcggtggcgtacggcgttggcgccgaagcggag
tggtatggccgcgcgggtgtctcggtgcgtggcgatctctatgctctgctgggggcttcg
aaaagtctcgcgttgcagcagatttaccaggcgatgctcggtatcgcgtacaatttcgag
cgctcagggccgctcgcgccgttcgtcggttttcagcccgggtttggttttgcgtcggtt
agaaacggcattgccgatggtctctacctttaccccgtcatgtcgccgcttttcggcgcg
cacctgttcgccagcgaaggctggcaggtctcgggccatgttcgttacgtattcggcgaa
atgaattatgccgaaaccggggccgtctacctcagcgagtttagggcgggggttagcctc
gggcaaactttttaa

DBGET integrated database retrieval system