KEGG   Turneriella parva: Turpa_1988Help
Entry
Turpa_1988        CDS       T02157                                 

Definition
(GenBank) CO dehydrogenase/acetyl-CoA synthase delta subunit, TIM barrel
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2026866..2027198
Genome map
AA seq 110 aa AA seqDB search
MKKLFTILSLVIAATFVAPVMAQEASTAPAAAETKESKAAAKKAAAEEKKAKAKAAREEK
AAKAKAAKEEKAAKAKAAKEAKAAAKAEKAAKAKAEKEAKAAEKAAKAGK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgttcacaattctgtcgctcgtcatcgctgcgacattcgtagcgcccgta
atggcacaagaagcatctactgcaccagcggcagcagaaacaaaagaaagcaaagcggca
gctaaaaaagcagcggcagaagaaaagaaagccaaagcgaaagcagcacgcgaagaaaaa
gcagcgaaagctaaagcagcgaaagaagaaaaggcagctaaagcaaaggcagccaaagaa
gctaaggcagcagccaaagcagaaaaagcagctaaagcgaaagctgaaaaagaagcaaaa
gcagcagaaaaagccgctaaagctggcaaataa

DBGET integrated database retrieval system