KEGG   Turneriella parva: Turpa_2012Help
Entry
Turpa_2012        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
  KO
K09117  
uncharacterized protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2052053..2052478)
Genome map
AA seq 141 aa AA seqDB search
MLFERMQKESLEARKARDTVKAGVLTTALSQVKAIAIDDGHRAPNDADVLKVVRQFLKSV
EENLALAAQGKMDASRADAFKVEKEVLLSYLPQQMSADDLRAALKKSGAKNIGEAMKYLK
ANHDGQYDGKLASEIAKEVIV
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgctctttgaacgtatgcaaaaagaaagcctcgaggcgcgcaaagcacgcgacaccgtg
aaggccggggttctgacgacggcactttcgcaggttaaggcgatcgcaatcgacgacggc
caccgggcgccgaatgacgcagacgttctgaaagtcgtgcgccagtttctgaagagcgtc
gaagagaacctggcgcttgccgcgcagggtaaaatggacgccagccgcgccgacgcattc
aaagtcgaaaaagaggtattgctctcttacctgccgcagcagatgagcgccgacgacctg
cgggcggcgctgaagaaatcgggcgcgaaaaatatcggtgaggccatgaaatacctcaag
gcaaaccacgacggccaatatgatggtaaactggcttcagaaatcgcaaaagaggtaatc
gtatga

DBGET integrated database retrieval system