KEGG   Turneriella parva: Turpa_2013Help
Entry
Turpa_2013        CDS       T02157                                 

Definition
(GenBank) metal dependent phosphohydrolase
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_5 GAF GAF_2 HD GAF_3
Motif
Other DBs
NCBI-ProteinID: AFM12659
UniProt: I4B5V2
Position
2052617..2054587
Genome map
AA seq 656 aa AA seqDB search
MVSHIYFDPALSRITLESFRDQVIFATINDNLAIKPRTADEEHAVVWLVTSSSLTENAQV
ISNWLQKYPQHRSRIIVLGDHDFSELLFSPLSEQQIHLYLPAGISMTQVRKACESQINAL
YAEYDRLSLQEKLANSYIEIRRLTAVGQALATERDFDRLIELVLNSAIELTSADGGSIYL
SEKHGSGDKPTHIRFKKSAMQLDAGEFLLPIDKKSIAGYVALTVEPLLIDDVHNLPVDAG
YTYNSEYDKAHHYYTKSMMVIPMKNHHEEVIGIIQLINRKRDADAKLTLAELKGDAVMSF
TRKDYSLVSAMAGQAAVAIENNQLLQDIQNLFEGFVKASVTAIEQRDPTTSGHSFRVADY
AVNIAMAVNRDTGARFNSVRFTRNQIQELRYASLLHDFGKVGVREDVLVKAKKLYPSQLE
LIRWRFHFIKKDVEAGVLRNMLAELKKSPAEKWPEIEARHELELQKNLLEAEEMFSAILS
ANEPTVLAAGSFDFLKKIAERKVKLSADHAVPYLHDNELVMLSIRKGTLDEQERQEIESH
VTHTYNFLRQIPWTPNLRWVPEIAYGHHEKLNGNGYPLKRRDPEISLQTRMMTIADIYDA
LTAWDRPYKKAIPPEKAIDILWMEVKDGHVDSELLNVFIDAKVYARIDELRAVENR
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtggtctcgcatatctattttgacccggcgctttcacgaattacgctcgagtcgtttcgt
gatcaggtcatctttgcgacgatcaacgacaacctcgcgatcaagccgcgcacggcagac
gaagagcacgcagttgtgtggctcgtgacttcgtcttcgctgactgaaaacgcgcaagtt
atctcgaactggctgcagaaatacccgcagcaccgatcgcgcattatcgtgctcggcgat
catgatttttctgagctattgttctcgccgctgagcgaacagcagattcacctttacctg
ccagcgggcatcagcatgacacaggtgcgtaaggcctgtgaatcgcagatcaatgccctc
tacgcagaatacgaccggctgagcctgcaagaaaagctcgccaacagttatattgaaatt
cggcgtctcacggcagtcggtcaggcgcttgccaccgaacgcgatttcgaccgcctcatt
gaactggtattgaattcggcgatagaactcaccagcgccgacggcgggtcgatttacctc
agcgagaagcacggcagcggcgacaaacccacgcacatacgtttcaagaagtcggcgatg
cagctcgatgcgggcgaatttctgctgccgatcgacaaaaagtcgattgccggttacgtg
gcgctcaccgtcgagccgctcttgatcgacgacgtgcacaatctgccggtcgacgccggc
tacacgtataactcagaatacgacaaagcgcaccactattacaccaagtcgatgatggtg
attccgatgaagaaccatcacgaagaagtgatcggcattattcagctgattaaccgcaag
cgcgacgccgatgcgaaactgaccctcgctgaactcaaaggcgatgccgtcatgtcgttc
acgcgcaaagactattcactcgtgagcgcgatggcagggcaggcggcggtggcgatagag
aacaaccaactgctgcaagacattcagaatctgttcgagggttttgtcaaagcttcggta
acggcaattgaacagcgcgacccgacgacgagtggtcattcgtttcgcgtcgccgactat
gcggtgaatatcgcgatggcggtgaaccgcgacacgggcgcgcgctttaattcagtgcga
ttcacgcgcaaccagattcaagagctgcgctacgcttcgctgctgcacgactttggtaag
gtcggtgtgcgagaagacgttctcgtaaaagcgaagaaactctacccgagtcagctcgag
ctgattcgctggcggttccatttcataaaaaaagacgttgaggcgggcgtgttgcgtaac
atgcttgcagaacttaaaaaatcccccgctgagaagtggcccgaaatcgaggcgcggcac
gagcttgaattgcaaaagaatctgctagaagccgaagagatgttctcggcgattctttcg
gcgaacgaaccgactgtgctcgctgccggttcattcgacttcttgaaaaaaatcgccgag
cgcaaggtgaaactttcggctgaccatgcggtgccctatctgcacgacaatgaactcgtg
atgctctctatccgcaaaggcactctcgacgaacaagagcggcaagagatcgagtcgcat
gtgacgcacacctataattttctgcggcagataccgtggacgccgaacctgcgctgggtg
cccgagatcgcgtatggccaccacgaaaaactcaacggcaatgggtatccgctcaagcgg
cgcgaccctgagatttcgctgcagacgcgcatgatgacgattgccgacatctacgatgcg
ctgaccgcctgggacaggccgtacaaaaaagcgataccgcccgagaaggcgatcgacatt
ctctggatggaagtcaaagacggccacgtcgacagcgaacttttgaacgtgtttatcgac
gcgaaggtctacgcacgcatcgacgaactgcgcgcggtcgaaaatcgttag

DBGET integrated database retrieval system