KEGG   Turneriella parva: Turpa_2014Help
Entry
Turpa_2014        CDS       T02157                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2054591..2055277
Genome map
AA seq 228 aa AA seqDB search
MQALPVHPFLRGVVAKAFVTGHASADTYRVMPSVYTVIGFQFEGRIDHVSENRALSIFGV
TGILDKWREFRSEPKTESLLLFFEPGGFYRLFGAVAGELGSASLAMHDVVPSRVTRGISE
ILETGKELSQKWQRVQHLLLQLLSRDLSPEAMGALYHLQTNRGERRISQIAKDLAVSPRT
LERRFAAQIGASPKHLARIMRWREAMQNLSRARAGKFCRAVSGGLVPD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagctttaccggttcaccctttccttcgcggcgttgtcgcgaaagcttttgtcacg
ggccatgcaagcgccgacacctatcgggtgatgccgagtgtctacacggttatcggcttt
cagttcgaggggcgcatcgaccacgtttctgaaaaccgtgcgctcagtatattcggtgtt
acgggaattctcgacaagtggcgcgagtttcgcagcgagccgaagacagaatcgctgctg
ctgtttttcgaaccgggtggcttttaccgtctttttggcgcggtcgcgggtgaactcggc
agcgcgagcctggcgatgcacgatgtcgtgccttcgcgcgtgacgcggggcatcagcgaa
attctcgaaacgggcaaagagctttcacagaaatggcagcgcgtgcagcatttacttctg
caacttttgtctcgtgacctgtcgcctgaagctatgggtgcgctctaccatttgcagacg
aaccgcggtgaacgccgtataagccaaatcgcaaaagacctcgcggtgagcccccgaaca
ctcgagcgccgttttgccgcccaaatcggtgcctcgcccaaacacctcgcacgcatcatg
cgctggcgcgaggcgatgcaaaatctcagtcgcgccagagcgggcaagttttgccgggct
gtttcaggcggtctggtacctgattga

DBGET integrated database retrieval system