KEGG   Turneriella parva: Turpa_2015Help
Entry
Turpa_2015        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2055354..2055749
Genome map
AA seq 131 aa AA seqDB search
MAEHRELDRAYENLKRAFEAEAHVAEPEKFAADLNRFSAAFQTHMNREEDELEPMVWAHF
SDEEIHEHRRRIMAADGPEKLLKYFRFVFFALNEQQIAGMLGRLKAMFPEDAYRRAEELA
AAASKRRHMRL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaccgcgaactcgaccgcgcatacgaaaacctgaagcgcgcattcgaggcc
gaagcgcacgtggcagagcctgaaaaattcgccgctgatctgaaccgtttcagcgccgcg
ttccagacccacatgaaccgcgaagaagacgagctcgaacccatggtttgggcgcatttc
agcgacgaagagatacatgagcaccgccgccgcatcatggcagccgacggccccgagaag
ctgctcaaatattttcgcttcgttttcttcgcgctgaatgaacagcaaatcgcaggcatg
ctcgggcggctcaaggccatgtttcccgaagatgcctaccgacgggccgaagagcttgcc
gcagccgccagcaagcgccggcacatgcgtctctga

DBGET integrated database retrieval system