KEGG   Turneriella parva: Turpa_2016Help
Entry
Turpa_2016        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SID-1_RNA_chan
Motif
Other DBs
NCBI-ProteinID: AFM12662
UniProt: I4B5V5
Position
2055789..2056184
Genome map
AA seq 131 aa AA seqDB search
MEILLKAGAVFMIIALALAWLLVAVKYLGLFGGFITNAKYLLSAHLDYIFMAILNWLTFA
LFNQLHLPAAKEMLWLIVAGSALNPALFVFLSIKPDVKKSIFSPFGMASGFSFTLTSAGY
GWAALVVGGFL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaaattctactcaaagcgggcgcagtgttcatgatcatcgcgctcgcactcgcatgg
ttgctcgtcgcggtaaaataccttggccttttcggcggattcatcacgaacgcaaaatat
ctactcagtgcacacctcgactacatctttatggcgattctaaactggctcaccttcgcg
ctcttcaaccaactacacctacccgcagcaaaagaaatgctgtggctgatcgtcgccggc
tcagcgctcaacccggcgctcttcgtgttcttatcgattaaacccgacgtgaagaagtcg
atcttctcacccttcggcatggcctcgggtttttctttcacgctgacgagcgccggttac
gggtgggcggccttggtggtgggtggatttttgtag

DBGET integrated database retrieval system