KEGG   Turneriella parva: Turpa_2019Help
Entry
Turpa_2019        CDS       T02157                                 

Definition
(GenBank) transcriptional modulator of MazE/toxin, MazF
  KO
K07171  mRNA interferase MazF [EC:3.1.-.-]
Organism
tpx  Turneriella parva
Brite
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Turpa_2019
Prokaryotic defense system [BR:tpx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    Turpa_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin
Motif
Other DBs
NCBI-ProteinID: AFM12665
UniProt: I4B9N0
Position
complement(2058531..2058854)
Genome map
AA seq 107 aa AA seqDB search
MVVEQYDVFLINLDPTIGHEIKKTRPCLIISPNEMNGNISTIIIAPMTTVSRNYPTRVKT
VFKKKTGYIVLDQIRTVDKARLVKKLGKVNIEAIGSVKSVLREMLID
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggtagtggaacaatacgacgtatttctgataaatcttgatccgactatcggccatgag
attaagaaaaccaggccctgccttatcatatcaccaaatgagatgaatggtaatatttct
acgataatcatcgcccctatgacaactgtttcgcgaaattatccgacacgagtgaaaaca
gtattcaagaagaagaccggatatatagtcctcgaccagattcgtacggtcgataaagcg
cgtttagttaagaagcttggtaaggtcaatattgaagccattggctcagttaagtcagtt
ttgcgagaaatgcttatagattag

DBGET integrated database retrieval system