KEGG   Turneriella parva: Turpa_2022Help
Entry
Turpa_2022        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12668
UniProt: I4B5W1
Position
2059996..2060181
Genome map
AA seq 61 aa AA seqDB search
MNGQRFTTKFSRCARDHLRLGRVLGLGRQESLTPHARDVHSVRRNEATFSKLIVRQAAAF
E
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcaacggtttacaacaaaatttagccgctgcgcgcgcgaccacctgcggctg
ggtcgtgtgctcggcctcggtcgccaggagtcgttgacgccgcacgcacgtgacgtgcat
tcggtgcggcgcaacgaggcgaccttcagcaaattaatagtgcgccaagccgcggctttc
gaatga

DBGET integrated database retrieval system