KEGG   Turneriella parva: Turpa_2023Help
Entry
Turpa_2023        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2060250..2061062
Genome map
AA seq 270 aa AA seqDB search
MLFAAIHGGARCLCVENCMKNNKKRYDWLRPTIRDWAAFAIFVIFSAVTPLVFSNNSDLG
IYCLVFFGFGSTVAGLTVFRKIRESKFDGSSVDVIGGVAIRPSRLRLMVYAFGLSIFGAT
MAVFGTGMPIFLRLIGGGLLALGITMVILGLLKKLPAGFIRFDVDRFVLGNRRYTIGIEW
DNMARIEPGNIHDNSAVFVWLKSPQAIQVEPSKSITSALKSISWTEQWYGAHLALITEIY
GLPGPMVAAALTRYKSHPEAREELRNKYIT
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttattcgccgccatccatggcggtgcacgatgcctgtgtgttgaaaattgcatgaag
aacaataagaagcgatatgattggttacgtccaacgatacgtgattgggctgcatttgca
atcttcgtaatttttagcgcggtcacgcctttggttttttcgaacaatagcgatttaggc
atatattgcttagtcttttttggctttggtagcaccgttgccggtctaactgtttttcgg
aagattcgcgaaagtaaatttgatggttcatcggttgatgtcattggcggcgtagcaatt
agaccttcgcgcctacgcttgatggtgtatgcctttggactttctatttttggcgcgacg
atggctgtttttggcaccgggatgcccatatttctcaggctaattgggggcggcctcttg
gctctagggataacaatggtgatcttaggccttctaaagaagttaccagcaggtttcatc
cgcttcgacgttgatcgtttcgtcctgggaaataggcgttatactatcggcatagaatgg
gacaatatggcccgaatcgaaccgggcaacatacatgataattccgccgtgttcgtctgg
ttaaaatctccgcaagcgattcaggtcgagccatccaaatcaattacttccgctctaaaa
tccatctcatggactgaacaatggtacggtgcacatttggcgttaattacggaaatatat
ggtctgccaggccccatggttgcagctgctttaactcgatataaatcccatccagaggca
agagaagagcttagaaacaaatacataacttaa

DBGET integrated database retrieval system