KEGG   Turneriella parva: Turpa_2027Help
Entry
Turpa_2027        CDS       T02157                                 

Definition
(GenBank) thiazole biosynthesis family protein
  KO
K03149  thiazole synthase [EC:2.8.1.10]
Organism
tpx  Turneriella parva
Pathway
tpx00730  Thiamine metabolism
tpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Turpa_2027
Enzymes [BR:tpx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.10  thiazole synthase
     Turpa_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiG NanE FMN_dh His_biosynth UreE_C IMPDH BURP
Motif
Other DBs
NCBI-ProteinID: AFM12673
UniProt: I4B5W6
Position
complement(2063887..2064675)
Genome map
AA seq 262 aa AA seqDB search
MKSPDSDTLALGPVSLNSRLIVGTGRYPTLEIMQACHRVAETQMVTVALRRIEVRDSNRS
ASLVDHVDTTNITLLPNTAGCAFAADALRLARIAAAMGNTHLKIEVTGDVQTLLPDPIET
LKAVELIKADPASKHLYLMVYTSDDPVMARRLADAGAECIMPAASPIGSGRGVANEANLT
ILLTMMRGRLPVIVDAGIGTPSHAARAMELGADAVLLNTAIAKAKDPVLMAAAMRDAVKA
GRAGFLAGAIPAKLYATASSPQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ctgaaatctccagattctgataccttagccctcgggcccgtttcacttaattcacgcctc
attgtgggtaccggccggtatccgaccctcgaaattatgcaggcatgccaccgcgtcgcc
gaaacgcagatggtgaccgttgcgctgcgccgcatcgaggtcagagacagcaaccgttct
gcatctctggtcgaccatgtcgacacgacaaacatcaccctgctaccgaacaccgcgggc
tgtgcctttgccgctgacgctctgcggctggcgcgaatcgcggccgcgatgggcaacacg
cacctcaagatcgaagtcacaggcgacgtgcagacgctgctgcccgacccgattgaaacg
ctgaaagccgtcgaactcattaaagccgaccccgccagcaagcatctctacctcatggtc
tacacgtcagacgacccggtgatggcgcgccgtctcgccgacgcgggtgccgaatgcatt
atgcccgccgcgagccctatcggcagcggccgcggtgtcgccaacgaagcgaacctcacg
atcttgctcacgatgatgcgcgggcgtttgccggtgatcgtcgacgccggtatcggcaca
ccctcgcacgcggcacgcgcgatggaactcggcgccgacgcagttctgctcaacaccgca
atcgcaaaagccaaagacccggttctcatggcagcggcgatgcgcgatgcagtcaaagca
ggccgtgccggatttctagcgggggcaataccggcgaagctgtatgcgactgctagcagc
ccgcaatga

DBGET integrated database retrieval system