KEGG   Turneriella parva: Turpa_2028Help
Entry
Turpa_2028        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12674
UniProt: I4B5W7
Position
complement(2064672..2064911)
Genome map
AA seq 79 aa AA seqDB search
MKDIEIAKILYLAKSKKYEVACASFDVVDHLFKLDVPKGLKRRKSSVQTLSMLADEKVKF
GYDRKEAVAVADDDENETD
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacatcgaaattgccaaaatactctacctcgcgaaaagcaaaaaatatgaggtt
gcctgtgccagcttcgatgtcgtagaccatctttttaagctcgacgtgcccaaaggcctc
aaacgccgcaaaagctctgttcagacgctgagcatgctcgccgacgaaaaagtcaaattt
ggctatgaccgcaaagaagcggttgcagtggctgatgacgacgaaaacgaaaccgactga

DBGET integrated database retrieval system