KEGG   Turneriella parva: Turpa_2036Help
Entry
Turpa_2036        CDS       T02157                                 

Definition
(GenBank) glycosyl transferase family 9
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2074729..2075754)
Genome map
AA seq 341 aa AA seqDB search
MKEILVMRFSAIGDILLTTPVVAALKKQYPGARITFLVKAQHKAFIAACPQVDRIVEWQK
SDSLFEIRKKLADVSRYDLIADLQSNLKSRVLSLLISAHQKRHYKKPYLNRILLVWLKKN
RYTEKLRVSDRYFASLEGLVEKPPDLAVSLSRTKLPKPLEKFIAEPATLIAPGARWLTKR
WPAEYFASLASKILEKLPTQRIVWLGGPDETEIFQFLKEHPYLKRHAKRMMFLQAELSVT
QMAALADGVKVIVANDSGLMHLLSAAKTPLVALFLSTVEEFGFYPLGGSAEVLAARNISC
RPCNHKGLAACPKLHFRCGRELTADQVYGAVAAHLVPVTPE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaaattctggtcatgcgcttcagcgccataggcgacatcttgctgacgacgccg
gtggtcgccgctctcaaaaagcaataccctggcgcgcgaatcacttttctggtgaaggcg
caacacaaggcttttatagccgcctgcccgcaggtcgaccgcatcgttgaatggcagaaa
tctgactcactgtttgagataagaaaaaaactggcggatgtctcacgttacgatctgatc
gccgatttgcagagcaacctcaagtcacgtgtactttcgctcttgatcagcgcgcatcaa
aagcgccattacaagaaaccatacctcaaccgcatcttgctcgtgtggctgaagaaaaac
cgctacaccgaaaaactgcgcgtgagcgatcgttattttgcgtcactcgagggtttggtt
gaaaagccgccagatctggcggtcagtctgtcgcgtacaaaactgccaaagccgctcgaa
aagtttatcgctgaacctgcgacgctcatcgcgcccggcgcgcgttggctgaccaaacgc
tggcccgctgagtactttgcatcgcttgcttcgaaaattcttgagaaactaccgacgcag
cgaattgtctggttgggcggccccgatgagactgaaatttttcagttcttgaaagaacac
ccatacctcaagcggcatgcgaagcgcatgatgttcttgcaggccgagctgagcgtcacg
caaatggcggctctcgccgacggggtaaaggtcatcgtcgccaacgacagcggtctcatg
cacctgctttcggcagcaaaaaccccgcttgtcgcgctttttctgagtacggttgaagag
ttcggtttttatccgttaggtgggtcggctgaagtgctcgcggcgcgcaatatcagttgc
agaccctgcaaccacaagggcctcgctgcctgcccgaaactgcactttcgctgcgggcgc
gagctcactgctgaccaggtctatggcgccgtcgcggcacacctggtgcccgttacgcct
gaatag

DBGET integrated database retrieval system