KEGG   Turneriella parva: Turpa_2043Help
Entry
Turpa_2043        CDS       T02157                                 

Definition
(GenBank) UPF0082 protein yeeN
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2082037..2082789)
Genome map
AA seq 250 aa AA seqDB search
MAGHSKWKNIQHRKGAADAKRGAMFTKLAKEIMVAAKLGGGDESANPRLRTATLKARQNS
MPKDNIERAIKKGTGELEGVTYEEGVYEGYGPGGIAIMVEVLTDKKSRTVPELKSTFKTN
GGTMAEANAVAYLFDKKGLILVEGDNITEDDVMEIALDAGAEDIEKDDEKVFAVKTSVND
FHAVLSAMEPKLAAKGYKIVESALKYIPQTTITVEGEKAKEALELIEALEDNDDVQNVYT
NLELTDAMMA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcaggccatagtaagtggaaaaatattcagcaccgcaagggcgcggcagacgcgaag
cgcggcgccatgttcacgaaactggcgaaagagattatggttgcggcaaagctgggtggc
ggtgatgaatccgcaaacccgcgcttaagaaccgccacgctcaaggcccggcagaacagc
atgcccaaagacaacatcgaacgggcgatcaagaagggcaccggcgaactcgagggcgtg
acctatgaagaaggcgtctacgaaggttatggtccgggcggcatcgcgatcatggttgaa
gtgctgaccgacaagaagtcacgcaccgtgcccgagctcaagagcactttcaagactaac
ggcggcactatggccgaagccaacgcggttgcatacctttttgataagaagggcctcatt
ctcgttgaaggcgacaacattaccgaagacgacgtcatggaaatcgcgctcgatgcgggc
gcagaagacatcgagaaagacgatgaaaaggttttcgccgtcaaaaccagcgtgaatgat
tttcacgcagtgctgtcggctatggagccaaaacttgccgcgaaaggttacaagatcgtt
gaatcggcgctcaagtacattccgcagacgaccattacggttgaaggcgaaaaggcgaaa
gaggcgctcgaactgatcgaagcgcttgaagacaatgacgacgtgcagaacgtgtacacg
aatctcgagctgaccgacgcaatgatggcgtga

DBGET integrated database retrieval system