KEGG   Turneriella parva: Turpa_2063Help
Entry
Turpa_2063        CDS       T02157                                 

Definition
(GenBank) Methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
tpx  Turneriella parva
Pathway
tpx00670  One carbon pool by folate
tpx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Turpa_2063
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Turpa_2063
Enzymes [BR:tpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     Turpa_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Motif
Other DBs
NCBI-ProteinID: AFM12709
UniProt: I4B602
Position
complement(2104201..2105184)
Genome map
AA seq 327 aa AA seqDB search
MTGKTRIVFWGSPGIAASFLRDLVHNHSDRFVITACVTQTEKTIQRQGKTAARSKVHDTA
LELGLPVLTPKSVKKEAREILSTLSTFGYDLFVVVAYGKILPQSIIDAPPLKSVNFHGSL
LPLLRGASPIEHSLLYGFRETGWTLQRIVEKLDAGDIIAQSQVVIDENETTGTLYEKLSA
DLIQNGAQMLADYADGKVTPRPQDESAATHCGKISAEDGRLNFERPAHEIFNRCRAFTPR
PGVFAMFRGKKVKLALSPPPVPLPTRGEGVPEAGVGTLTKHGKTDLSVVCGDGNVLNIVS
VTPEGKKPMAVADFMNGYRLQDGDRFE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtaaaacccgcatagtcttctgggggtcgcccggtattgctgccagttttttg
cgtgatctggtgcacaaccacagcgacaggtttgttatcacggcgtgtgttacccagaca
gaaaagacgatacagcggcagggcaagacagcggcacgctcgaaggtgcacgatacggct
ctcgaactcggcctgcccgtgctgacgccgaagtcggtcaagaaagaggcccgtgaaatt
ctgagcacgctcagcacttttggctatgatctttttgtcgtcgtcgcgtatggcaaaatt
ctgccgcaatcgattatcgatgctccgccgctcaaatcagtcaactttcatggcagcctg
ctaccgcttctgcgcggcgcatcacccatcgaacactcattattgtacggctttcgtgaa
accggctggactctgcaacgcatcgtcgaaaaactcgacgctggcgacatcatagcacag
tcgcaggtcgttatagatgaaaatgaaaccaccggcactctttacgaaaaactcagcgcc
gacctgattcaaaacggcgcacaaatgctcgccgactacgccgacggcaaggtaacgccc
cgaccacaagacgaatctgcggcgacgcactgcggaaagatctcggcagaagatggcaga
ctaaatttcgaaaggcctgcgcatgaaatcttcaatcgctgccgcgccttcaccccccgc
ccgggcgtttttgccatgttcaggggcaagaaggtgaaattggcattgtccccacccccc
gtccccctccccacacgtggggagggggtgccagaggcgggggtggggacactcaccaaa
cacggcaaaaccgacctctctgtagtctgcggcgacggtaacgtgttgaacatagtctcc
gtgacccccgagggcaaaaagccgatggcagtcgctgattttatgaacggctatcgcctg
caagacggcgaccgattcgaatga

DBGET integrated database retrieval system