KEGG   Turneriella parva: Turpa_2069Help
Entry
Turpa_2069        CDS       T02157                                 

Definition
(GenBank) ATP-binding cassette protein, ChvD family
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_tran_Xtn SMC_N AAA_23 AAA_29 AAA_16 AAA_15 AAA_18 MMR_HSR1 ATPase_2 AAA_13 Roc AAA_22 DLIC NB-ARC AAA_27 cobW DUF3584
Motif
Other DBs
NCBI-ProteinID: AFM12715
UniProt: I4B608
Position
complement(2111359..2113032)
Genome map
AA seq 557 aa AA seqDB search
MADDKKIIFSMVGVSKVYPPHKQVLKDIYLSFYYGAKIGIIGLNGSGKSSLLKIIAGVLK
SDKGEVVFSPGYSVGYLEQEPQLDESKTVRQIVEEGAGEVVSLLKEYEAVSESLGTDLSD
DEMEKAIERQGELGELIEKANGWELDNMLRRAMDALNCPEETAVIKNLSGGEKRRVALCR
LLLQKPKVLLLDEPTNHLDAESVQWLEQHLQEYEGTVIAITHDRYFLDNIAGWILELDRG
EGIPWKGNYSSWLEQKSNRLANEEKAESKRRKTLERELEWVRMGAKGRQAKSKARLGAYE
KLLSEDAKEKESKLEIYIPDGPRLGDKVIIAEGVSKGYGDRLLYENLNFELPPNGIVGVI
GPNGAGKTTLFRMIMGLEKPDAGKFTVGETVKISYVDQQHSAIDPNKSVFDVISGGAQEV
KVGKISVNARAYMARFNFSGADQEKKCGTLSGGERNRLHMALALKEGGNVLLLDEPTNDI
DVNTVRALEEGLESFAGCAVVISHDRWFLDRVATHILAFEGDAQVRFFAGGFSEYEEDRK
KRLGGEPPRFKYKKLVK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgacaaaaaaataatattctcaatggtgggggtgagcaaagtttacccgccg
cacaagcaggtgctgaaagatatctatctttcattttattatggggcgaaaatcggcatc
atcggcctcaatggttcgggtaaatcatcgctcctcaaaattatcgccggtgttctcaag
agcgacaaaggcgaagttgtattctctcccggctattcagtgggatatctggagcaagag
ccgcaactcgacgaatcgaaaactgtacgccagattgtcgaagaaggtgcgggtgaagtt
gtttctctcttaaaagaatacgaagctgtcagcgaaagtctcggtaccgacctcagcgat
gacgaaatggaaaaggcgatcgaacgccagggcgagctgggtgaactgattgaaaaggcc
aacggctgggagctcgacaatatgctgaggcgcgcgatggatgcgctcaactgccccgaa
gaaacagcagtcattaagaatctttctggcggcgagaagcgtcgcgtggccctttgccgc
ctgctgctgcaaaagcccaaggtgctgctgctcgacgaacccacgaaccatctcgatgca
gaatcggtgcaatggttagagcagcacctgcaagaatacgaaggcactgtgattgcaatc
acgcacgaccgttattttctcgacaatatcgccggctggattctcgaactcgatcgcggc
gaaggtattccctggaagggaaattactcttcttggctcgaacagaaatcgaatcgcctc
gccaacgaagaaaaggccgaatcgaagcgccgcaaaacgctcgaacgcgagcttgaatgg
gtacgcatgggcgcaaaaggccgccaggccaaatcgaaggcacgtctcggcgcgtatgag
aagttactgagcgaagacgccaaagaaaaagaaagcaagctcgagatctatattcccgat
gggccgcgcctgggcgataaggtcattattgctgaaggtgtgagcaagggttatggtgac
cgcttgctttatgaaaatctcaatttcgagctaccaccgaacggcattgtcggtgtcatc
ggcccgaacggtgcgggtaagacgacgctcttcagaatgattatggggttagagaagccc
gatgcaggtaaatttacggttggcgaaaccgtgaaaatttcttacgtcgaccagcagcat
tcggcaatcgatcccaataagtcggtctttgatgtcatttcaggcggggcgcaagaagtt
aaggtcggtaaaatttcagtcaacgcgcgagcttacatggcgcgcttcaatttcagtggc
gccgatcaggaaaaaaagtgcggcacgctctcgggcggtgaacgcaatcgcctgcatatg
gcactcgcgctcaaagaaggcggtaacgtgctgctgctcgacgaacccacgaacgacatc
gacgtgaacacggtgcgggcccttgaagaaggcctcgagagctttgcgggctgcgctgtt
gtgatctcgcacgaccgctggtttctcgaccgcgtcgcgacgcacattttggctttcgaa
ggcgatgcgcaggtgcgcttttttgccggcggtttttctgaatatgaagaagaccgcaag
aaacgcctgggcggcgaacccccccggttcaaatacaagaaactggtaaaatag

DBGET integrated database retrieval system