KEGG   Turneriella parva: Turpa_2071Help
Entry
Turpa_2071        CDS       T02157                                 

Definition
(GenBank) 7TM receptor with intracellular metal dependent phosphohydrolase
  KO
K07037  uncharacterized protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TMR-HDED 7TM-7TMR_HD HD HDOD
Motif
Other DBs
NCBI-ProteinID: AFM12717
UniProt: I4B610
Position
complement(2114071..2116488)
Genome map
AA seq 805 aa AA seqDB search
MSEPRPYQRLRALGVRLNKRLATARDFNEVKRATLIGYGATLFVSVLMLSLPLMQKLPRF
ALGDVATGDLKAQMDLRIADDNETERLKKAAFERERPAFDRDFEAFEKSLKQLQTEFTWI
ARTATEAAQMSVAERRELILGRMPFLADSLYRSEDIDGLFREKQIQQIESRALTLAEKAF
QENGFLTQTLETKILAEVIEKGAQIRTINAPRDAPDVVWSAEQLQTKETAVRLILRNNQL
KDAALSPGTMRVILTRIRQLQREIPSLVYNPQYTLLRRNQAAEKITPVYKSVKRGSTLLR
AGDLITEENLRLLEQVRENHRRRNGSQIIGIFLIMGVLAVSLSYFTFRFAYEQVRDYGSH
FILHGLFWVIFAIGLVIMKLNPLRVYDISFILFVPFGFFGILTGQFFGARIALSAGIYLS
IFFYILTGFDNQSLMLALTSAIAGLYASTRMQKRTQMFKGGVIIAITNLIIITGFELLAP
AARNYELKFAAIVTNSILSILLTLGLLPLIEMVFNLPTPFRLMELNDFNHPLLTRMAAIA
PSTHSHSVMLANLSEAAVRALGGDTLLTRVGCLFHDIGKMAHPDFYAENRHLYPTSEAFK
KLGPVKSAHMITRHVTDGIAMARENRLPEKIISFIPEHHGTTTIQYFYHKALEQAKPGTP
PVSRKSFQYPGPRPQTRETAVVMIADSVEAASRTAASATKEEFAEIIDRIIQNKISEEQF
HEAPLTLGELALVRKAFLDVLVSTYHERPHYPTMQETRALENQAAKKSSSLREVSVQTDA
EKRSVSKKAAQKPRRSKSALPRLID
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgcgcccctaccagagattgagggcgctgggcgtgcgcctgaataagcgc
ctcgccaccgcgcgcgatttcaacgaggtcaagcgcgcgactctgattggttacggcgcg
acactctttgtttcagtgctgatgctttcattgccgctgatgcaaaagctaccgcgcttt
gcactcggcgatgtcgcaacgggcgacctcaaggcgcaaatggacctgaggatcgccgac
gacaatgaaaccgagcggctaaagaaggcggccttcgagcgcgaacgcccggctttcgac
cgcgacttcgaagctttcgaaaaatcgctgaagcagctgcagaccgaattcacgtggatt
gcgcgcaccgctaccgaagccgcgcagatgtcggttgccgaaagacgcgaactgattctt
ggccgcatgccgtttctcgccgacagtctttaccgcagcgaagatatcgatggtttgttt
cgtgaaaaacagattcagcagatcgagagccgggcgctgacgctggcagaaaaagccttt
caggaaaatggctttctcacgcaaacactcgaaactaaaattctcgctgaagtgattgaa
aaaggcgcacagatcagaacgatcaatgcgccgcgcgacgcgcccgatgttgtgtggagc
gccgaacaactgcagacaaaagaaactgctgtgcggctgattctgcgtaacaaccagctc
aaagacgcggcactctcgcccggcaccatgcgcgttattctgacacgcattcgacagcta
cagcgcgagataccgtcgctcgtctacaatcctcaatacaccttgctcaggcgtaatcag
gcggctgaaaagattacgccagtctacaaatcggtgaagcgcggctcgacgctgctgcgc
gcgggcgacctcatcaccgaagaaaacctgcggctgctcgaacaggtgcgcgaaaaccat
cgccgcagaaacggctcacagataatcggtatctttctgatcatgggcgtgctcgcagtc
tcgctgtcatattttacatttcgttttgcgtacgagcaggtgcgtgactatggctcgcat
ttcattctgcacgggctcttctgggtcatctttgccatagggctggtaatcatgaagctg
aacccgctcagagtctacgatatcagctttattctgtttgttccgtttggtttttttggc
attctgaccggccagttctttggggcccgcatcgccctctcggcgggcatttatctctcg
attttcttctatattcttacaggcttcgacaaccagagcctgatgctggctctcacctcg
gcgatcgcgggcctatacgcctcaacacgcatgcagaagcgcacgcagatgttcaaaggt
ggggtcatcatcgccatcacgaatctgattattatcacgggcttcgagctgctggccccg
gcggcgcgaaactatgaactgaagttcgcggcaatcgtcacgaacagtattctgagcatc
ttattgactctggggttgttgcccctgatcgagatggtattcaatctgccgacgcccttt
cgcctcatggaactcaacgacttcaaccaccctctgctgacgcgtatggccgcgattgcc
ccgtcgacgcattcgcacagcgtcatgctcgccaacttaagcgaagctgccgtgagagcc
ctcgggggcgacacgctgctcacgcgcgtgggttgtctgtttcatgatattggtaaaatg
gctcaccctgatttttatgcggagaaccggcacctctacccgacatctgaagccttcaaa
aaactggggcccgtcaagtctgcacacatgattacccggcatgtgaccgacggcatcgcc
atggcgcgcgaaaaccgcctacctgaaaaaatcattagttttattccagagcaccacggc
acgacgacgattcagtatttttaccacaaggcactcgagcaggcaaagccgggaacaccg
cctgtctcgcgcaagagttttcaatatccggggccgaggccgcagacgcgcgagactgcg
gttgtaatgattgccgacagcgtcgaagcggcatcgcgtaccgcggcctcggcgactaaa
gaagaatttgcagaaataatcgaccgcattattcaaaacaagatcagcgaagaacagttt
cacgaagcaccgctcactctcggcgagcttgctctggtgcgcaaggcatttctcgacgtg
ctcgtcagcacttaccatgaaaggccacactaccccacgatgcaagaaactcgcgcactc
gaaaaccaggcagcaaaaaagagctctagcttaagggaagtttctgtacagaccgacgca
gaaaagaggtcagtctcgaaaaaggcggcacaaaagccaagacggtctaaatccgctttg
ccgcgcctgattgactga

DBGET integrated database retrieval system