KEGG   Turneriella parva: Turpa_2072Help
Entry
Turpa_2072        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2116495..2116977)
Genome map
AA seq 160 aa AA seqDB search
MADAKKPAQGPDTQFSENEVLARIESILRFTTDELANSEVRAQAFEKLTEFEAQLLYQQR
NISTALENVQKYRDEIEKEWHKEKQVRENTLDLMAQRMKDLHQTLRAQEYLLDYAAGEQK
FLRELLVQLHNKKSLTEQDVEKILGEHEQLLAELSRKAKK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgccaaaaaaccggctcaggggccagatacgcaattctctgaaaacgaggtt
ctggcgcgcattgaaagcattctgcgtttcaccaccgacgagttggcaaattctgaagta
cgggcgcaggcgtttgaaaagctgaccgaattcgaagcacagctgctctatcagcagcgc
aacatcagcactgcgctcgagaacgtgcagaaatatcgtgacgaaatcgaaaaagagtgg
cataaagagaaacaggtacgcgaaaacaccctcgacctgatggcgcagcgcatgaaagat
ctgcaccagaccctgcgcgctcaggaatatctgctcgactatgctgccggcgaacaaaaa
tttctgcgtgaactgctcgtgcaactgcacaataaaaaatcacttaccgaacaagacgta
gaaaaaattctcggcgaacacgaacagctgctggctgaactcagccgcaaagcaaaaaaa
taa

DBGET integrated database retrieval system