KEGG   Turneriella parva: Turpa_2073Help
Entry
Turpa_2073        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LAGLIDADG_2
Motif
Other DBs
NCBI-ProteinID: AFM12719
UniProt: I4B612
Position
2117051..2117779
Genome map
AA seq 242 aa AA seqDB search
MRETPPIDPKLKAAIDAAIANEHLVRIRAYAVISATEAGLSYIVEQVLNKYGRHDMIGPV
YTSVKELSLNGAKANFKRILFEDEKIDGENEAEYDRGMDLFKEQLNEQWVLEYGKKSKER
RLYVDIFFDFNRDRLIIEVLNNRPISPKEDKRIREKFHTAMRYDDIAQFYMEGGDSSEGA
GMGIVLVTMMLKAQDIDPHLFTIRSDYREKTLARVEFPLSSDYQPNRQRFITESNAELVL
SV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaacgccccccattgaccccaaactcaaggccgcgatcgatgcggcgatcgcg
aatgagcacctggtgcgaattcgcgcctatgcggtgatatcggccaccgaggcgggctta
agttacattgtcgaacaggtgttgaacaaatatggccgccatgacatgatcggcccggtc
tacacctcggtcaaagaactttcactcaacggcgccaaagcaaactttaagcgaatattg
tttgaagacgagaagatcgacggcgaaaacgaagcggaatacgatcgcggcatggatctt
ttcaaagagcaactcaacgaacaatgggtgctcgaatatggcaagaagtcgaaagagcgc
cgcctctacgtcgatattttcttcgactttaaccgtgaccggctgatcattgaagttctg
aacaaccggccgatcagccccaaagaagacaagcgtatccgcgaaaaattccacactgcg
atgcgatacgatgatattgcgcagttctacatggaaggtggcgatagttctgaaggcgcc
ggcatgggcatcgtactcgttacgatgatgctcaaagcgcaggacatcgatccgcatctt
ttcactatccgctctgactaccgcgaaaagacgctcgctcgggtggagtttccgctttca
tctgactaccagcctaaccggcagagatttattacagaatcaaatgctgagctggtgctg
agtgtgtaa

DBGET integrated database retrieval system