KEGG   Turneriella parva: Turpa_2202Help
Entry
Turpa_2202        CDS       T02157                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tpx  Turneriella parva
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpx01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tpx00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2268159..2268950)
Genome map
AA seq 263 aa AA seqDB search
MNSALASRLEAATHVILKFGTGVLTEHIEKRSNKYFRQIAKECLELKKRGKKVIIVSSGA
VGFGRAILKQQQALQLPQASVSEKQALASLGQSLLIETYRNAFARYRLAAAQILVTRTDF
ENKRHLQNLRSTLNQLLEWGAIPVINENDAIANEEIKVGDNDNLSADVAVLYPKSVLVLL
TTIDAFYADGKRVPQITRITADIKRHAGSASGGGTGGMVTKLQAAEKMLRANQVMSIASG
KKIQIVRRLMAGADLGTWFSSGK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagcactcgcctcgaggttagaggccgccacgcacgtgatcttgaagttcggc
acgggagttctcaccgaacacattgaaaaacgcagcaataaatatttcaggcagatcgcg
aaagagtgcctcgagctcaaaaaacgcggcaagaaagtgatcattgtctcatcgggagcc
gtagggtttggccgcgccatattgaagcagcagcaggcgctgcagctgccgcaggcttcg
gtgagcgaaaaacaggcgctcgcctcgctcggccagagtttgctgattgaaacgtaccga
aatgcattcgcccgttatcgcctggctgcagctcagattctggtgacgcgcaccgacttt
gagaacaagcgccacctgcagaatctgcgttcgacattaaaccagctgctcgaatggggc
gcgatacccgtgatcaatgaaaacgacgcaatcgccaatgaagagatcaaggtcggcgat
aatgacaacctctcagccgatgtcgccgtgctctacccgaaatcggtactggtgctgctg
accacaatcgacgcgttctacgccgatggcaaacgcgtgccacaaatcacacgcatcact
gcggatatcaaaagacacgcaggcagcgcatctggtggcggcaccggcggaatggtcacc
aaacttcaggcagctgaaaaaatgctgagagcaaatcaggtaatgagcatagcatcgggc
aaaaaaatacaaatcgtgcgcaggctgatggcaggcgctgaccttggtacgtggtttagt
tcaggcaaatga

DBGET integrated database retrieval system