KEGG   Turneriella parva: Turpa_2252Help
Entry
Turpa_2252        CDS       T02157                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpx  Turneriella parva
Pathway
tpx00010  Glycolysis / Gluconeogenesis
tpx00260  Glycine, serine and threonine metabolism
tpx00680  Methane metabolism
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01130  Biosynthesis of antibiotics
tpx01200  Carbon metabolism
tpx01230  Biosynthesis of amino acids
Module
tpx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tpx_M00002  Glycolysis, core module involving three-carbon compounds
tpx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Turpa_2252
  Energy metabolism
   00680 Methane metabolism
    Turpa_2252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Turpa_2252
Enzymes [BR:tpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Turpa_2252
Membrane trafficking [BR:tpx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Turpa_2252
Exosome [BR:tpx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Turpa_2252
  Exosomal proteins of melanoma cells
   Turpa_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFM12897
UniProt: I4B6J0
Position
complement(2320171..2320851)
Genome map
AA seq 226 aa AA seqDB search
MAKLVLIRHGQSLWNLHNLFTGWVDVPLSAQGVQEAIAAGKRLSHEKFDIIYTSTLIRAI
TTAMIVMSENLEGKVPILQKENAEKPGDWFKIYSPASEANSIPVYSAWQLNERMYGELQG
MNKEETAKKFGDAQVKIWRRSYDVPPPQGESLKDTAARSIPWFEKNIEPKLKEGKNILVA
AHGNSLRSIIMHLEKLTEAQVLELELKTGEPVVFNAERGTIVRSAG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactcgtcttgattcgccacggccagtcgctgtggaacctgcacaacctcttc
accggatgggtcgacgtgccactctcagcacagggcgttcaagaggcgattgccgcaggc
aagcgactctcacacgaaaaattcgatatcatttatacatccaccctgatacgcgccatc
acgactgcgatgattgtcatgtctgaaaacctggagggcaaagtgccgattctgcaaaaa
gaaaacgcagaaaaacccggcgactggttcaagatctattcacccgcttctgaggcgaac
agcattcccgtctattcagcgtggcagctcaacgagcgcatgtacggtgaactgcaggga
atgaataaagaagaaacagcgaagaagtttggcgatgcgcaggtgaaaatctggaggcgc
agctacgacgttccgccaccgcagggtgagtcgctgaaagacactgctgcgcgctcgata
ccctggtttgaaaaaaacatcgagccgaagctgaaagaaggcaagaatattctcgtcgcc
gcgcatggcaatagtttgcgctcaatcatcatgcaccttgaaaagctgaccgaagctcag
gtgctcgaactcgaactcaaaaccggtgagccggtggtgttcaacgccgagcgcggcacg
atcgtgcggagcgccggctaa

DBGET integrated database retrieval system