KEGG   Turneriella parva: Turpa_2252Help
Entry
Turpa_2252        CDS       T02157                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpx  Turneriella parva
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Turpa_2252
   01230 Biosynthesis of amino acids
    Turpa_2252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Turpa_2252
  Energy metabolism
   00680 Methane metabolism
    Turpa_2252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Turpa_2252
Enzymes [BR:tpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Turpa_2252
Exosome [BR:tpx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Turpa_2252
  Exosomal proteins of melanoma cells
   Turpa_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2320171..2320851)
Genome map
AA seq 226 aa AA seqDB search
MAKLVLIRHGQSLWNLHNLFTGWVDVPLSAQGVQEAIAAGKRLSHEKFDIIYTSTLIRAI
TTAMIVMSENLEGKVPILQKENAEKPGDWFKIYSPASEANSIPVYSAWQLNERMYGELQG
MNKEETAKKFGDAQVKIWRRSYDVPPPQGESLKDTAARSIPWFEKNIEPKLKEGKNILVA
AHGNSLRSIIMHLEKLTEAQVLELELKTGEPVVFNAERGTIVRSAG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactcgtcttgattcgccacggccagtcgctgtggaacctgcacaacctcttc
accggatgggtcgacgtgccactctcagcacagggcgttcaagaggcgattgccgcaggc
aagcgactctcacacgaaaaattcgatatcatttatacatccaccctgatacgcgccatc
acgactgcgatgattgtcatgtctgaaaacctggagggcaaagtgccgattctgcaaaaa
gaaaacgcagaaaaacccggcgactggttcaagatctattcacccgcttctgaggcgaac
agcattcccgtctattcagcgtggcagctcaacgagcgcatgtacggtgaactgcaggga
atgaataaagaagaaacagcgaagaagtttggcgatgcgcaggtgaaaatctggaggcgc
agctacgacgttccgccaccgcagggtgagtcgctgaaagacactgctgcgcgctcgata
ccctggtttgaaaaaaacatcgagccgaagctgaaagaaggcaagaatattctcgtcgcc
gcgcatggcaatagtttgcgctcaatcatcatgcaccttgaaaagctgaccgaagctcag
gtgctcgaactcgaactcaaaaccggtgagccggtggtgttcaacgccgagcgcggcacg
atcgtgcggagcgccggctaa

DBGET integrated database retrieval system