KEGG   Turneriella parva: Turpa_2392Help
Entry
Turpa_2392        CDS       T02157                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Turpa_2392
Enzymes [BR:tpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Turpa_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2478120..2479751)
Genome map
AA seq 543 aa AA seqDB search
MVQVQDSYDYVIIGSGFGGSVSALRLSEKGYKVLVIEKGKWFKPQDFPKSNWQLRKWLWL
PSLKMFGLFKMTIFRHVTIFSGVGVGGGSLVYANTLPVPKRPFFKSDSWAHLADWEKELK
PHYATALRMIGAAQTPARFDGDNTLKSLAADLGKEKSYDQTNVAVYFGKPGVTVKDPFFK
GKGPDRTGCIYCGACMLGCTHNAKNTLDKNYLHLAQGLGAEILATSEVVDVKPISGEHAY
EITYRDSTKYFSREGKVRANGVVFAGGVLGTIQLLLKLKAKKSLPNISDRLGYGIRTNSE
SLLGVTTERRDLNFSKGVAIGSILHVDDHSHLEVVRYPEGSGFFRMSMVPAVLGSNIFVR
IGRILWQYLRHPVKYFKAIIVPDWAKYTQIMLFMQSLDSTMRLKRGWLRMKTALDQGAAP
TSDIPIAHELAQKYADKVKGSVHALATEALTGLASTAHILGGSCMGDSPATGVIDSENRV
FGYDNMYICDGSMISANIGVNPSLTIMALTERAMSHIPRKTKTVNMVRQPATAKKGKGKL
VRR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggttcaagactcttatgactatgtgataatcggctcgggattcggcggctca
gtttcggcgctgcgcctcagcgaaaagggctataaggtgctcgtgattgaaaagggcaag
tggtttaaaccgcaagattttcccaagtcgaactggcagctgcgcaagtggctgtggctg
ccctctctcaagatgtttggactctttaagatgaccatctttcgccacgtcacgattttt
tcgggcgtgggcgtcggcggtggttcgctcgtttacgccaatacgctgccggtaccgaaa
cgtcctttctttaaatcagacagctgggcgcatctcgccgactgggaaaaagagctgaag
ccccactacgccacggcgctgcgcatgatcggcgcggcacagacacccgcgcgcttcgac
ggcgacaacacgctgaagagcctcgcggccgaccttggcaaagagaagagctatgaccag
acaaacgtcgcggtttactttggcaaacctggcgtcaccgtcaaagacccgttcttcaag
ggcaaaggccccgaccgaactggctgcatctactgcggggcgtgcatgctcggctgcacc
cacaacgccaaaaacacactcgataaaaattatctgcatctcgcgcagggcctgggcgca
gaaattctggccaccagcgaggtggtggatgtaaaaccgatcagcggcgaacacgcttat
gaaatcacctaccgtgattcgaccaaatatttcagccgcgagggcaaagtgcgcgcgaac
ggcgtcgtcttcgccggcggcgtactgggtacaatccaactgctgctgaagctcaaggcg
aagaaatcgctgcccaatatttcagatcgtttgggttacggcattcgcacgaattcagaa
agccttctgggcgtcacgaccgagcgccgcgacctcaacttttcgaaaggcgttgcgata
ggttccattctgcacgtcgacgaccatagccatcttgaagtggttcgttaccccgaaggt
tcgggcttcttcagaatgtcgatggtgcctgcggttttgggttctaacattttcgtgcgc
atcgggcgcatcttgtggcaatacctgcgccacccggtgaaatattttaaagcgatcatc
gtgcctgattgggcgaaatacacgcagatcatgctcttcatgcagagcctcgattcgacg
atgcgcctcaagcgcggctggctgcgcatgaaaacagccctcgatcagggtgccgcgccg
acatctgatatacccatcgcgcacgagctcgcgcagaaatatgccgacaaggtcaagggt
tcggtgcatgcgctcgcgactgaagcgctcacaggcctcgccagcaccgcgcacattctc
ggtggttcttgcatgggtgattcaccggcaacgggcgtgatcgacagtgaaaaccgcgtg
ttcggttacgacaacatgtacatctgcgacggctcgatgatctcggcgaatattggcgtc
aacccatcactcacgatcatggcgctcaccgaacgcgcgatgtcgcatatacctcgaaaa
accaagaccgtgaatatggtacgacaaccggcaaccgccaaaaagggcaaaggcaaactg
gttcgccgctaa

DBGET integrated database retrieval system