KEGG   Turneriella parva: Turpa_2626Help
Entry
Turpa_2626        CDS       T02157                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpx  Turneriella parva
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Turpa_2626
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Turpa_2626
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Turpa_2626
Enzymes [BR:tpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Turpa_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2702335..2703672
Genome map
AA seq 445 aa AA seqDB search
MAAKKKPAKAKAKPKAEASKKIEIPEGYFGEFGGRFVSDLLIPALDELSAAWKKFSNDKK
FQKELLGLYNDYAGRPSLLTYAANLSQRYQAQIYLKREDLLHTGSHKINNTLGQALLAQK
MKKKRIIAETGAGQHGVATATAAALMKIPAHVYMGSEDLRRQALNGFRMRLLGATVSGVG
GEHGTLRDAVNEALRDWAKNVDDTYYLIGSAIGPHPYPTMVRTLQSVIGREARQQILKAE
GRLPQAVFSCVGGGSNALGMFYGFLKDTKVQLIGAEAGGRALTPGNHSASLTAGKPGVLQ
GAMTYIIQTPDGQVQDVHSISAGLDYPGVGPEHAYLLKQGRTEYVAVRDKAALEAFQELA
QEEGIIPALESAHAVAAAKNYIADLRKQGKKNPLILICLSGRGDKDVQEVERLLALPQEP
ELPEDAPAAPQFNTVPTVKVVAAGE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagaaaaagccggcaaaggcgaaagccaagcccaaagctgaagcaagtaag
aaaattgaaatccccgaagggtattttggcgaatttggcggcaggtttgtctctgacctg
ctgattcccgcgctcgatgagctgagcgcagcctggaaaaaattcagcaacgataaaaaa
tttcagaaagaattgctcgggctatacaatgactatgccgggcgcccttcgcttctgacc
tacgcggcgaatttgtcgcagcgctaccaggcgcagatttatctgaagcgcgaagacctg
ttgcacaccgggtcgcacaagatcaataacacactcgggcaggcgcttctcgcgcaaaag
atgaaaaagaagcgcattatcgccgaaaccggggcagggcagcacggtgttgcgacagcg
accgcggcggcgctgatgaagattcccgcgcatgtctatatgggttcagaagaccttagg
cgccaggcgctgaatggctttcgcatgcggcttctcggtgcgacagtttctggagtcggc
ggcgaacacggcacgctgcgcgacgcggtcaatgaagcgctgcgcgattgggcgaaaaac
gtcgatgacacgtattacctcatcggttctgcgattggtccgcacccttacccgacaatg
gtgcgcacgctgcaatcggtgatcggccgtgaagcgcgccagcagattttgaaagccgaa
ggcaggttaccgcaggcggtattttcatgcgtcggcggtggttcaaatgcgctcggcatg
ttttacggatttctgaaagacacgaaggtgcagctgatcggcgccgaagccggcggccgc
gcgctgacccccggtaaccattcggcttcgcttaccgccggcaaacccggcgtgctgcag
ggggcaatgacctacatcattcagactcccgatggccaggtgcaagacgtgcattcgata
tcagcgggtcttgattatcccggtgtggggcctgagcatgcatatctcttgaaacaaggt
agaaccgaatacgttgctgtgcgcgacaaggccgcgctcgaagcgtttcaagagctggcg
caagaagagggcatcattcccgcgctcgagtcggcgcatgccgtcgccgctgcgaagaac
tacatcgccgatctgcgcaagcagggaaaaaagaatcctttgattctgatctgtctttcg
ggtcgcggcgacaaagacgtgcaagaggtcgaacgcctgctcgcgctgccgcaagagcct
gaactgcccgaagacgcgcctgccgcaccgcagttcaatacggttccgacagtgaaagtg
gtagcggccggcgaataa

DBGET integrated database retrieval system