KEGG   Turneriella parva: Turpa_2777Help
Entry
Turpa_2777        CDS       T02157                                 

Definition
catalytic domain-containing protein of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tpx  Turneriella parva
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Turpa_2777
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Turpa_2777
   00020 Citrate cycle (TCA cycle)
    Turpa_2777
   00620 Pyruvate metabolism
    Turpa_2777
Enzymes [BR:tpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Turpa_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2869838..2871097)
Genome map
AA seq 419 aa AA seqDB search
MAKLATITQLSPTMKEGVFVEWVKKEGDAVKPGDVIAAIETDKAVMDLEAFDAGTLLKQL
AQKGDKLLVGAPVAVIGEPGEDFSALVAGAGAKSPASAAPETPAAPEQKQPVNRAPAAIP
AESVPAKPTGRIKASPLAKKIAAQTGTDLSQIEGTGPQGRIVSRDLAGAPATGPRVRAGT
RQNNTKIPMTPMRQTIATRLSESKQTVPHFYLSRTVNFSALLKLRLETNAGLEKLHAAGS
GAHLPKKVSVNDFIIAAVAATLPDHPAVMRQFMGDHFLQLGNADVGFAVSLEDGLITPII
RNADQLTLFEIAAASADLAARARARKLKPEEYTGGTFTISNLGMMGITSFQAIINAPEAA
ILAVGASERRAVEGKDGSIVFADMLTLNLACDHRVVDGAAGAAFLGDLAIYLENPGVIR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacttgcaaccattacccagctttcaccgactatgaaagaaggtgtgttcgtc
gaatgggtcaaaaaagaaggcgatgcagtcaaaccgggcgacgtcattgcggctatcgaa
accgataaagcagtgatggatctcgaagccttcgatgccggtacgctgctgaagcaactc
gcgcaaaaaggcgacaagctactcgtcggtgcaccggtagccgtgattggtgagcccggc
gaagatttttcagcactcgttgcgggtgccggtgcgaaaagccccgcgagcgcagcgcct
gagacaccggccgcgcccgagcagaagcagcctgtgaatcgtgcgcccgctgcaatacct
gcagaaagcgtgcctgcaaagcccacgggccgaattaaagcctcaccgctggcgaaaaag
attgcggcacaaaccggaaccgatctctcgcaaatcgaaggcacggggccgcaaggccgc
atcgtcagccgcgatctcgcaggcgcgcctgcaaccggccctcgggttcgtgcgggtacg
cggcagaacaacacgaagattccgatgacgccgatgcggcaaacgatcgcaacgcggctc
agcgagtcgaaacagacggtgccgcacttttacctcagccgcaccgtgaatttcagtgca
ttgctgaaactgcggctcgagacgaacgccggtcttgaaaagctgcatgcagccggcagc
ggtgcgcacctgcccaaaaaggtttcggtcaacgactttattatcgcagccgtagccgca
actctgcccgaccacccggccgtgatgcggcaattcatgggcgatcactttctgcaactc
ggcaatgccgacgtgggttttgcggtcagtcttgaagacgggctcattaccccgataatc
agaaatgctgatcaactgacgctcttcgaaattgccgcggcttctgcagacctcgccgcg
cgcgcacgggcgcgtaaactaaaacccgaggagtacaccggcggcacgttcacgatctca
aatctgggcatgatgggaatcacctcgtttcaggcgattatcaatgcccccgaagcggcg
attctggcggtgggcgcaagtgaacgccgggcagtcgaaggcaaagacggcagcatcgtt
ttcgctgacatgctcacgctgaatcttgcgtgcgaccaccgggtggtcgacggggctgcc
ggtgccgcttttcttggcgaccttgcaatctatctcgaaaaccctggagttattcgatga

DBGET integrated database retrieval system