KEGG   Turneriella parva: Turpa_2949Help
Entry
Turpa_2949        CDS       T02157                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tpx  Turneriella parva
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3081331..3082332
Genome map
AA seq 333 aa AA seqDB search
MLWLVALVTIILILGHYGLPETVNPQAYQEAPSAIKIMRGAEPFRLQGKTDVGFLLVHGF
EDSPFTMRNIGELLHREGHTVIAPLLPGHGTTIKDFAKTRYEHWLSAVRETYARERPRFR
HFFLIGFSMGGNLCLTLSSQLRRDSQPTGIISIAAPVALNGILNGRPIVKDPRLFLSGLL
KNFISHIPKVQSAVAENVMIPWVGYSEAYTLAPLHSFKLGVQRVKSRLYRIRQPTCLIHA
TGDKTVHIENMHYIFRKISATEKRAYVFELNEDLSTHHVLVTHQLVRDKVFQYILRFVHD
TLRGFDLKPVIFNPGGDKSRFIDKLKKFRGYFS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctctggctcgtcgcactcgttacgattattctcattttggggcattacgggcttccc
gaaacggtaaatcctcaggcttaccaggaggcgccatcggcgatcaagatcatgcgcggg
gccgagccgtttcggctacagggaaagaccgacgtcggtttcttgctggtgcacggtttc
gaagattcgccgttcaccatgcgcaatatcggcgaactgctgcaccgcgaagggcacaca
gtgatcgcgcctctcttgccggggcatggcacgactatcaaagatttcgccaagacgcgc
tatgagcactggctgagtgccgtgcgtgaaacctatgcgcgcgagcggccccgcttcagg
cacttctttttgattggtttttcgatggggggcaatctgtgcctcacgctttcaagccag
ctgcgccgcgattcgcagccgaccggcatcatctcgatcgccgcgccggtggcgctgaac
ggcattctgaacggcaggccgatcgtcaaagacccgaggctctttttgtccgggctgctc
aagaattttatttcgcatattcccaaagtgcagtcggcggtcgccgaaaacgtcatgata
ccctgggtggggtacagcgaagcgtatacgctcgcgccgctgcactctttcaagctcggc
gtacagagagtcaaatcgcggctttaccgcattcgccagcccacctgccttattcatgcg
accggcgacaaaactgtgcacattgaaaacatgcactatatctttcgcaaaatatcggcg
actgaaaaacgcgcgtatgtctttgaactcaacgaagacctgagcacacaccacgttctg
gtaacgcaccagttggtacgcgataaggtttttcagtatatactgcgcttcgtgcacgac
acgctgcgcggcttcgatctgaaacccgtaatcttcaacccgggcggcgacaaaagccgc
tttattgacaaactcaaaaaatttcgcggctatttctcgtga

DBGET integrated database retrieval system