KEGG   Turneriella parva: Turpa_3050Help
Entry
Turpa_3050        CDS       T02157                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tpx  Turneriella parva
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tpx00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3186236..3186796
Genome map
AA seq 186 aa AA seqDB search
MFERPLFVISAPSGAGKNSLINVLLQKEPRLSHSISSTTRRQRGTEQEGVNYYFLSREEF
EKRVAEGAFLEYARVLDNYYGTEIRELERIFDSGKYPILDIDVQGAQTLRGKVRRMVSLF
IIPPDMQELERRLRARGSESEAEIQSRLQLARLEIMEKENFDYVVVNDDLMQAAEELAKI
VRAHMV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgcccgctctttgttatttcagcaccctcaggcgccggcaagaacagcctc
atcaacgttcttttgcaaaaagagccacgcctttcgcattcgatttcatcgacgacgcgg
cgccagcgcggcaccgaacaagagggagtgaactactattttctgagccgcgaagagttc
gaaaagcgcgtggccgagggtgcgtttctcgaatatgcgcgcgtgctcgataactattac
ggcaccgaaattcgcgagctcgaacgcattttcgattcgggtaaatacccgattctcgac
atcgacgtgcagggggcgcagacgctgcgcggcaaggtgcggcgcatggtgagtctcttt
attattccccctgacatgcaagagctcgaacgccgtctcagggcgcgcggttctgagagc
gaggccgagattcagagcaggctgcagcttgcgcgtctcgaaatcatggaaaaagaaaac
tttgactatgtcgtggtgaacgacgacctcatgcaggcagccgaagagcttgcgaagatc
gtcagagcgcacatggtctga

DBGET integrated database retrieval system