KEGG   Turneriella parva: Turpa_3161Help
Entry
Turpa_3161        CDS       T02157                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tpx  Turneriella parva
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tpx01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tpx01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3304441..3305583
Genome map
AA seq 380 aa AA seqDB search
MKLAVKRPPVGRTQWVSIAFLSLSPVIGFGSLAYFMTTGTLTSATLVLALVIATVAGMGT
TAGYHRLFSHRSYEAALPVRIVMLLIGLLGLQGSALEWSLDHRTHHKFVDRDKDPYSITK
GFWFAHMLWIFKTRARDWRPSHNADLFRDKFVFFQHRYFMPLAIAANFVLPAAIAGIFWG
DIWGGFLIAGFLRLVFTHHSTFFINSLCHIAGSQPYSDKHTARDNAITAFFTWGEGYHNF
HHEFANDYRNGVRWYQYDPGKWAIKLLSYLRLASNLKRVPDTTIKQRRMQMQKGELLSKL
EKWGWTEERQQLFRAQLDETFAAFRRRATVMNEIRNRMKTDAVQATQRRFELMQERYARL
QDAVEETAIQWKLLRRRARS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgctgttaaacggccgcccgtcggccgaacccaatgggtatcgatcgcgttt
cttagcctatcaccggtcattggctttggttcgcttgcgtatttcatgactaccggtacg
cttacttcagcgacgctggtgctggcgctggtgattgccaccgtcgctggcatgggcaca
accgccggctaccaccggctgttttcgcaccgttcatacgaagcagctttgccggtgcgc
atcgttatgctgctcatcggtctcctgggcctgcagggttcggcgctcgagtggtcgctc
gaccaccgcacgcaccacaagtttgtcgaccgcgacaaagacccgtacagcatcaccaaa
ggcttctggtttgcgcacatgctttggatcttcaaaaccagggcacgcgattggcggcca
tcgcacaatgccgacctctttcgtgacaaattcgtattttttcagcaccgctacttcatg
ccgctggcaattgccgccaactttgttctgcctgcggccatcgccggtatcttctggggc
gacatatgggggggatttctcatcgccgggtttctgcgcctcgtctttacgcatcactcc
accttttttatcaattcactctgccatattgccggctcgcagccatacagcgataagcac
accgcacgcgacaacgcgatcaccgcattcttcacgtggggcgaaggctaccacaacttt
caccacgaattcgcgaacgactaccgcaacggcgtgcgctggtaccagtacgatccggga
aaatgggcaattaagctcttgtcatatctgcgccttgcttcgaatctcaagcgcgtgccc
gacacaaccatcaaacagcggcgcatgcagatgcaaaagggcgagctgctctcaaaactg
gagaaatggggctggaccgaagagcgccagcagctctttcgtgcgcagctcgatgagacc
tttgctgcattcaggcggcgtgctacggtgatgaatgaaatccgcaaccgcatgaagacc
gatgccgtgcaggccacccagcgccgtttcgagctgatgcaagagcgttatgcacgcctg
caagatgccgttgaagaaacggcgatacaatggaaattgctgcgccgtcgtgcgcgttcg
tga

DBGET integrated database retrieval system