KEGG   Turneriella parva: Turpa_3161Help
Entry
Turpa_3161        CDS       T02157                                 

Definition
(RefSeq) fatty acid desaturase
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tpx  Turneriella parva
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Turpa_3161
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Turpa_3161
Enzymes [BR:tpx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Turpa_3161
Lipid biosynthesis proteins [BR:tpx01004]
 Desaturase
  First
   Turpa_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3304441..3305583
Genome map
AA seq 380 aa AA seqDB search
MKLAVKRPPVGRTQWVSIAFLSLSPVIGFGSLAYFMTTGTLTSATLVLALVIATVAGMGT
TAGYHRLFSHRSYEAALPVRIVMLLIGLLGLQGSALEWSLDHRTHHKFVDRDKDPYSITK
GFWFAHMLWIFKTRARDWRPSHNADLFRDKFVFFQHRYFMPLAIAANFVLPAAIAGIFWG
DIWGGFLIAGFLRLVFTHHSTFFINSLCHIAGSQPYSDKHTARDNAITAFFTWGEGYHNF
HHEFANDYRNGVRWYQYDPGKWAIKLLSYLRLASNLKRVPDTTIKQRRMQMQKGELLSKL
EKWGWTEERQQLFRAQLDETFAAFRRRATVMNEIRNRMKTDAVQATQRRFELMQERYARL
QDAVEETAIQWKLLRRRARS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgctgttaaacggccgcccgtcggccgaacccaatgggtatcgatcgcgttt
cttagcctatcaccggtcattggctttggttcgcttgcgtatttcatgactaccggtacg
cttacttcagcgacgctggtgctggcgctggtgattgccaccgtcgctggcatgggcaca
accgccggctaccaccggctgttttcgcaccgttcatacgaagcagctttgccggtgcgc
atcgttatgctgctcatcggtctcctgggcctgcagggttcggcgctcgagtggtcgctc
gaccaccgcacgcaccacaagtttgtcgaccgcgacaaagacccgtacagcatcaccaaa
ggcttctggtttgcgcacatgctttggatcttcaaaaccagggcacgcgattggcggcca
tcgcacaatgccgacctctttcgtgacaaattcgtattttttcagcaccgctacttcatg
ccgctggcaattgccgccaactttgttctgcctgcggccatcgccggtatcttctggggc
gacatatgggggggatttctcatcgccgggtttctgcgcctcgtctttacgcatcactcc
accttttttatcaattcactctgccatattgccggctcgcagccatacagcgataagcac
accgcacgcgacaacgcgatcaccgcattcttcacgtggggcgaaggctaccacaacttt
caccacgaattcgcgaacgactaccgcaacggcgtgcgctggtaccagtacgatccggga
aaatgggcaattaagctcttgtcatatctgcgccttgcttcgaatctcaagcgcgtgccc
gacacaaccatcaaacagcggcgcatgcagatgcaaaagggcgagctgctctcaaaactg
gagaaatggggctggaccgaagagcgccagcagctctttcgtgcgcagctcgatgagacc
tttgctgcattcaggcggcgtgctacggtgatgaatgaaatccgcaaccgcatgaagacc
gatgccgtgcaggccacccagcgccgtttcgagctgatgcaagagcgttatgcacgcctg
caagatgccgttgaagaaacggcgatacaatggaaattgctgcgccgtcgtgcgcgttcg
tga

DBGET integrated database retrieval system