KEGG   Turneriella parva: Turpa_3224Help
Entry
Turpa_3224        CDS       T02157                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tpx  Turneriella parva
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tpx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpx00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpx00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tpx00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tpx00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tpx00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3380193..3381110
Genome map
AA seq 305 aa AA seqDB search
MQRRILGIDIGATTVKFAAVTPEGSVAHRGALPVASAGNEQFVAQLASVIARPEFSDIDQ
VGIGSPGPLDLEAGKIITSANMPGVKDLALVAELSALYPRKQIRLENDANAATLGEKYFG
AGKNLGDFAVLTLGTGVGGGCVFNGKLQRGFRGNFFEVGHVNVAGIFADEPRRCGCGSDG
CLEAYASATGIAKSYELKTGERRSAADISALAMGGDGAAIECYRTAGRALGFAMAAITQL
LNVRKFVLTGGVAVAEPLLTPTLRAAYLQQTLGVFHDSFQLIFTRGDENAGILGAAALFL
EAEES
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcattctcggcatcgatatcggcgccacaacggtgaagtttgccgccgtg
acgcctgagggcagcgtcgcgcatagaggggcattgcccgtcgcctcggcgggcaatgaa
caattcgtcgcacaactcgcgtcggtcatcgcgcgccccgaattctctgatatcgaccag
gttggcattggttcacctgggccgcttgaccttgaagccggcaagatcatcacctcggcg
aatatgccaggcgttaaagacttggcgctcgtcgctgaattgagcgcgttatatccgcga
aaacaaatcaggctcgaaaacgacgccaatgccgcaacgctcggcgagaaatatttcggc
gctggtaagaatctgggtgattttgcagtgctgacgctcggcaccggtgtcggcggcggt
tgcgtcttcaatggtaaacttcagcgcgggttcaggggaaatttcttcgaagtcggtcac
gtgaatgttgccggcatttttgccgacgagccacggcgctgtggctgcggcagcgacggc
tgcctcgaagcgtatgcttcggcaacgggtattgcgaaatcttatgagcttaagaccggc
gagcgcaggtctgcggcagatatatctgccctcgccatgggcggcgatggcgctgcgatc
gaatgttacagaaccgcgggcagggcgttggggtttgcgatggcggcgatcacgcaactt
ctgaatgtgcgaaaattcgttctgacaggtggtgtcgcagtcgcagagcccctgctcaca
cccacgctgcgggcagcgtatttgcagcagacgctcggggtttttcatgattcgtttcaa
ctcatctttacccggggtgatgagaacgccggcattttgggtgcggcggcactctttctg
gaggccgaagaatcatga

DBGET integrated database retrieval system