KEGG   Turneriella parva: Turpa_3238Help
Entry
Turpa_3238        CDS       T02157                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tpx  Turneriella parva
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Turpa_3238
Enzymes [BR:tpx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Turpa_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3395876..3396760
Genome map
AA seq 294 aa AA seqDB search
MHSDSSLSPLGPAGSSPRVRGKGGRGERVQLWGVINLTPNSFFAGSRAEGLGALNRAAQM
LADGAAKIDVGAESTRPGAETISATDQLNVLFPFIDQFAAVHGQNNLSRISVDTRDIAVM
RACLDKGVTTINDVSGGDDAIYELVGKSGCDYVLMHTKGDPKTMQQAATYGNATAEVLAY
LQEHTEKLAAAGAKRTQIIWDTGIGFGKLAEHNLELIARHEIFSAHGVRLLAGVSRKSFI
GHFTGKSDPADRLIGTLAVQTYLTLRGLDILRVHDVKEMAETLKVISAIQHYEL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgcattctgatagctctctgtcccccctcggccctgcgggctcctcaccccgcgtgcgg
ggaaagggcggtaggggggagcgagtgcagctctggggagtcatcaatcttacgcccaat
tcgttttttgcgggttcacgcgctgagggtttaggtgcgctgaaccgcgctgcgcagatg
cttgccgacggtgctgccaaaatcgacgtcggcgccgagagcacgaggccgggggctgag
acgatttcagcgaccgaccagctgaacgtacttttcccctttattgatcaatttgccgca
gttcacgggcagaacaatctcagcagaatctctgtcgacacgcgcgatattgccgtgatg
cgtgcctgcctcgacaagggcgtcacgacgatcaatgacgtgagcggcggcgatgacgcg
atttacgagctcgtgggcaagagcggctgcgactatgtactgatgcataccaaaggcgac
ccgaagacgatgcagcaggcggcaacctatggcaatgccacagccgaagtgctggcatac
ctgcaagagcacactgagaagctcgccgcggccggcgcaaaaaggacacagatcatctgg
gataccggcattggttttggtaaacttgcagagcataatcttgaactgattgcccggcat
gaaatattctcggcgcacggtgtgaggctgctcgcgggagtttcgcgaaaatcgtttatt
ggccactttacaggcaagagtgacccggctgaccggctgatcggtacattggccgtgcaa
acgtatttaactttacgcggcctcgatattctgcgtgttcacgatgtgaaagagatggcc
gaaacactaaaggtgatttcagcgattcagcactatgaactttag

DBGET integrated database retrieval system