KEGG   Turneriella parva: Turpa_3684Help
Entry
Turpa_3684        CDS       T02157                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tpx  Turneriella parva
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Turpa_3684
  Amino acid metabolism
   00340 Histidine metabolism
    Turpa_3684
Enzymes [BR:tpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Turpa_3684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3845487..3846821
Genome map
AA seq 444 aa AA seqDB search
MSALLKTDHYATLTAAEKAALFSHSALNLNDIRSNTIEPLAAEFQQNAYTALKNALQRFE
GNVPEMLVLGESDMAAAAARVAKTQQETLAAFRLAAANIENFHELQRQRNFSADIAGNEL
GVRFVPFDRVALYVPGGKALYPSTVLMGVIPARIAGVRDITVMTPPDPQTGRVSDIVLAM
AHAAGATRVLQAGGAQAIFAAAYGVSELGLEAADFIYGPGNVYVSAAKIHVAGENRCGID
SFAGPSEVIVIADDSANARYVAHDLMAQAEHDENAQAILLTTSTELGTRVSAEIERSLAA
RSDDEKRKQITLDAIRRNGRVIIVDSLEDAVDISNRYAPEHLEIQTERNDEILAQIRCAG
SIFVGDHAPVAAGDYYTGTNHILPTAGAARYASGVSVYTFYRRITWQKVTRSGLEAGKDA
ISAMSRAEGLFAEHGYSVLTRFEE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgcttctcaagactgaccactacgcgacactaacagccgcagaaaaggctgca
cttttttcgcacagcgctctcaacctcaatgatattcgttcaaacacgatagaaccgcta
gcggctgaatttcagcagaacgcctacaccgccctgaagaatgcactgcagcggttcgaa
ggtaatgtgcctgaaatgctggtgctgggtgaaagcgacatggcagctgccgcggcacgc
gtcgcgaaaacgcagcaagagacgctcgcagcgtttcgcctcgcggctgccaatattgag
aactttcacgagttgcagcggcagcgaaatttttcagccgatatcgccggcaatgagctg
ggggtgcggtttgtgccgtttgaccgcgtcgcgctctatgtgccggggggcaaagcgctc
tacccctcgacggttctgatgggtgttataccggcgcgcatcgccggggtcagagacatc
acagttatgaccccacccgacccgcaaaccggcagggtatctgatatcgtgctcgcgatg
gcgcatgcggccggcgcgacgcgcgtgctgcaggccggcggtgcgcaggcaatatttgct
gccgcctacggtgtgagcgagctgggccttgaagctgcagatttcatctatgggcccggc
aatgtttatgtttcagccgcaaaaattcatgtggcgggtgaaaaccgctgcggcatcgat
tcgtttgccgggccgagcgaagttattgtcatcgccgacgattcggcgaatgctcgctac
gtggcccacgatctcatggcgcaggccgaacacgatgaaaacgcgcaggcaattctgctg
accacctcaactgagctcggtacacgggtgagcgccgaaattgaacgttcactcgcagca
cgcagcgatgacgaaaagcgcaaacaaattacactcgatgcaattcggcgaaatggccgc
gtgattatcgtcgactcgcttgaagacgcggtggatatctcgaaccgttacgcgcccgaa
caccttgaaatacagactgaacgcaacgacgaaattctggcgcagattcgctgcgccggc
agcatcttcgtcggcgaccatgcaccggtcgctgccggcgactactataccggcacgaac
catattctgccgactgcgggcgccgcgcgctatgcgtcaggggtgagcgtctacaccttt
taccggcgcattacctggcagaaggtcacccgatcggggcttgaggctggcaaagatgcg
atttcagctatgtcgcgcgccgaaggccttttcgccgagcacggctattcggtactcacg
cgttttgaagagtag

DBGET integrated database retrieval system