KEGG   Turneriella parva: Turpa_3768Help
Entry
Turpa_3768        CDS       T02157                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tpx  Turneriella parva
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tpx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3933442..3934050
Genome map
AA seq 202 aa AA seqDB search
MPPELLAAIEAIQSLPGIGRRSAMRIVFSLIEGGKTRVENFNHALTELVTRITACSRCGA
YTSRGADPAATGCVYCDNPRRDSASLCVVEQPSDIYAVENTGEHRGLYHVLGGVLSPLDG
IGPEELHLPELAERAARLGIKEVIVAANPSVEGNATAHYIADLLKPSGIRVTRIATGLAL
GQMLDFAETQAISQSIRQRVDL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgagctattggccgccatcgaggccattcaatcgcttcccggtatcggccgg
cgctccgcgatgcgtatagttttttctctgatcgaaggcggcaaaacccgtgttgaaaac
tttaaccacgcattgaccgaacttgtcacgcgcatcacggcctgcagccgctgcggtgcg
tatacgagccgcggtgcagaccctgcagcgacgggctgcgtctactgcgataatccgcgg
cgagacagtgcaagcctctgcgtcgttgagcagccgtcagatatttatgccgtcgaaaac
acaggcgaacaccgcggcctctaccatgtgctgggcggcgtgctttcaccactcgatggc
atcggccccgaagaactacacctgccagaacttgccgagcgcgccgcgcggctcggtatt
aaagaagtcatcgtcgcggcgaacccgagtgtcgagggcaatgcgacagcgcactacatc
gccgatctcttgaaaccgagcggcattcgcgtgacgcgcatcgcgaccgggctggcgctg
ggccaaatgctcgattttgccgagacgcaggcaatttcacagtcaatacgccagcgggtc
gatctgtga

DBGET integrated database retrieval system