KEGG   Turneriella parva: Turpa_4064Help
Entry
Turpa_4064        CDS       T02157                                 

Definition
Limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
tpx  Turneriella parva
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Turpa_4064
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Turpa_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4254085..4254516)
Genome map
AA seq 143 aa AA seqDB search
MIKVETSATTVVEEFLHALETLDMATAEALLDDNVVYQNVPLPADRGKTAAIATLKNFMR
IATAFEVRMHSIAERDGVVLTERTDILSGPGVHLEFWVCGTFTVKNGKITEWKDYFDILT
VMGQIAKSSPGIAAAFVKSLFNR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagtagaaaccagtgcaacaactgtcgtcgaagagtttctgcacgcacttgaa
actctcgacatggccacagccgaagcgttgctcgatgacaacgtggtataccagaacgta
ccgctgcccgccgaccgcggtaagacggcggcaatagcgacgctcaagaattttatgcgc
atcgccaccgccttcgaagtgcgcatgcactccattgccgagcgtgacggcgtcgtgctc
accgagcgcaccgacattctctcggggccgggcgtacatcttgaattctgggtttgcggc
acctttaccgtcaagaacggcaagatcaccgagtggaaagattacttcgatattctgacc
gtgatgggccagatcgcaaaaagctcacccggcatcgccgccgcgttcgtcaagagcctc
tttaaccggtaa

DBGET integrated database retrieval system