KEGG   Thermacetogenium phaeum: Tph_c05320Help
Entry
Tph_c05320        CDS       T02276                                 

Definition
D-fructose 1,6-bisphosphatase class V (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:tpz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpz00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tpz00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tpz00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:tpz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(551669..552766)
Genome map
AA seq 365 aa AA seqDB search
MGKKITLTVIKADVGGCVGHSSVHPELLEKAKEMLSGSPLLIDSYVTHVGDDINLIMTHE
AGRNNGEVHQLAWDVFVACTDVAKKLKLYGAGQDLLADAFSGNIKGLGPGIAEMEFEERE
SEPVIIFMADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHKGFDFDVRDTVENKKIIFS
TPEEIYDMLVFIGAPGRFCVKRVFQRETGDIAAVSSTQRLNLMAGRYVGKDDPVCIVRCQ
SGFPAVGEALEPFTYPHLVAGWMRGSHNGPLMPVALKDAHPTRFDGPPRVIALGFQLSEG
KLIGPQDLFDDPAFDRARELANNVADYMRRMGPFEPHRLPLDEMEYTTMPQVSKRLKERF
ISLRK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagatcactctcacagtaatcaaggctgacgtcggaggctgcgtcggacac
tcaagcgtacaccccgagttgctggaaaaagcaaaggaaatgctgagcggaagccctttg
ctcatcgactcctacgttacccatgtcggggatgatatcaacctgatcatgactcacgaa
gcaggccgcaacaacggagaagtgcaccagctcgcctgggatgtcttcgtcgcctgcacc
gatgtggccaagaaattgaagctctacggagcggggcaggacctcctggcagacgccttt
tccggaaatataaaggggttgggccccgggatcgccgagatggaattcgaagaaagagaa
agcgaaccggtcattatcttcatggcagacaagacggaaccgggagcgtggaacctcccc
ctgtacaaaatgttcgccgatcccttcaacaccatcggcctggttatcgacccgaagatg
cacaaaggctttgacttcgatgtgcgggataccgtcgagaataagaagatcatcttctcg
acgccggaggagatttacgacatgctggtctttatcggagcacccggccgcttctgcgtc
aaacgggtcttccagcgggagacgggggatatcgccgccgtctccagcacccagcggctc
aatctcatggcgggacgctatgtaggaaaggacgatcccgtctgcatcgtccgctgccag
agcgggttccccgcagtaggtgaggctctggagcccttcacctatccccatctggttgcg
ggctggatgcgcggttcccacaacgggcccctgatgcccgtggccctcaaagacgcccat
cccacacggttcgacggcccgccgcgggtgatcgccctgggcttccagctcagcgaagga
aaactgatcggaccgcaggatctcttcgacgatcccgcctttgacagggcacgagagctg
gccaacaatgtggccgattacatgcgccgcatggggcccttcgaaccgcatcgcctgccg
ctcgatgagatggaatacacgaccatgccgcaggtatcgaaaaggcttaaggaacgcttt
atcagcttaagaaaataa

DBGET integrated database retrieval system