KEGG   Thermacetogenium phaeum: Tph_c05320Help
Entry
Tph_c05320        CDS       T02276                                 

Definition
(GenBank) D-fructose 1,6-bisphosphatase class V
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00010  Glycolysis / Gluconeogenesis
tpz00030  Pentose phosphate pathway
tpz00051  Fructose and mannose metabolism
tpz00680  Methane metabolism
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01120  Microbial metabolism in diverse environments
tpz01130  Biosynthesis of antibiotics
tpz01200  Carbon metabolism
tpz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c05320
   00030 Pentose phosphate pathway
    Tph_c05320
   00051 Fructose and mannose metabolism
    Tph_c05320
  Energy metabolism
   00680 Methane metabolism
    Tph_c05320
Enzymes [BR:tpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Tph_c05320
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Tph_c05320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AFV10770
UniProt: K4LFM4
Position
complement(551669..552766)
Genome map
AA seq 365 aa AA seqDB search
MGKKITLTVIKADVGGCVGHSSVHPELLEKAKEMLSGSPLLIDSYVTHVGDDINLIMTHE
AGRNNGEVHQLAWDVFVACTDVAKKLKLYGAGQDLLADAFSGNIKGLGPGIAEMEFEERE
SEPVIIFMADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHKGFDFDVRDTVENKKIIFS
TPEEIYDMLVFIGAPGRFCVKRVFQRETGDIAAVSSTQRLNLMAGRYVGKDDPVCIVRCQ
SGFPAVGEALEPFTYPHLVAGWMRGSHNGPLMPVALKDAHPTRFDGPPRVIALGFQLSEG
KLIGPQDLFDDPAFDRARELANNVADYMRRMGPFEPHRLPLDEMEYTTMPQVSKRLKERF
ISLRK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagatcactctcacagtaatcaaggctgacgtcggaggctgcgtcggacac
tcaagcgtacaccccgagttgctggaaaaagcaaaggaaatgctgagcggaagccctttg
ctcatcgactcctacgttacccatgtcggggatgatatcaacctgatcatgactcacgaa
gcaggccgcaacaacggagaagtgcaccagctcgcctgggatgtcttcgtcgcctgcacc
gatgtggccaagaaattgaagctctacggagcggggcaggacctcctggcagacgccttt
tccggaaatataaaggggttgggccccgggatcgccgagatggaattcgaagaaagagaa
agcgaaccggtcattatcttcatggcagacaagacggaaccgggagcgtggaacctcccc
ctgtacaaaatgttcgccgatcccttcaacaccatcggcctggttatcgacccgaagatg
cacaaaggctttgacttcgatgtgcgggataccgtcgagaataagaagatcatcttctcg
acgccggaggagatttacgacatgctggtctttatcggagcacccggccgcttctgcgtc
aaacgggtcttccagcgggagacgggggatatcgccgccgtctccagcacccagcggctc
aatctcatggcgggacgctatgtaggaaaggacgatcccgtctgcatcgtccgctgccag
agcgggttccccgcagtaggtgaggctctggagcccttcacctatccccatctggttgcg
ggctggatgcgcggttcccacaacgggcccctgatgcccgtggccctcaaagacgcccat
cccacacggttcgacggcccgccgcgggtgatcgccctgggcttccagctcagcgaagga
aaactgatcggaccgcaggatctcttcgacgatcccgcctttgacagggcacgagagctg
gccaacaatgtggccgattacatgcgccgcatggggcccttcgaaccgcatcgcctgccg
ctcgatgagatggaatacacgaccatgccgcaggtatcgaaaaggcttaaggaacgcttt
atcagcttaagaaaataa

DBGET integrated database retrieval system