KEGG   Thermacetogenium phaeum: Tph_c05330Help
Entry
Tph_c05330        CDS       T02276                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase GtaB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tpz  Thermacetogenium phaeum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tph_c05330 (gtaB)
   00052 Galactose metabolism
    Tph_c05330 (gtaB)
   00500 Starch and sucrose metabolism
    Tph_c05330 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    Tph_c05330 (gtaB)
Enzymes [BR:tpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tph_c05330 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
553505..554473
Genome map
AA seq 322 aa AA seqDB search
MQKNEVRKAIIPAAGWGTRFLPATKAQPKEMLPIVDKPAIQYTVEEAVASGIEDIIIVTG
RNKRAIEDHFDRALELEIILKEKGQEELLHLIEDISNLVDIHYVRQKEALGLGHAVYCAR
KFIGDEPFAVLLGDDLIDAQVPCLRQLLDIYEERRAPVLAIQQVPEEDVSRYGIIRPAAL
EDSASLFRVEDLVEKPAVGEAPSRYAVIGRYIITPEIFDIIETLPPGAGGEIQLTDALCR
LAKRRPIYAYLFSGERYDVGDKLGFLEATVKFALGRPELGRSFLGFLRKLVLENHEDGGE
MDAGESGGRSQQGAAVPPARWR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaagaatgaagtgagaaaggccatcatcccggctgccggatgggggacgcgcttt
ctgccggccaccaaagcccagcccaaagagatgctccctatcgtggacaaaccggccatt
cagtacacggtcgaagaggcggttgcctccggaatcgaggatatcatcatcgtcaccgga
aggaacaagcgcgccatcgaagaccacttcgacagggcactggagctggagatcattcta
aaagaaaagggacaagaggaactcctgcacctgatcgaagacatttccaatctggtcgac
attcactatgtgcggcagaaggaagccctcggcctcggccatgccgtttactgtgcccga
aagtttattggggacgagccctttgccgtgttgttgggtgatgatctcatcgacgcgcag
gtgccctgcctgcgccagctgctcgatatctacgaggaacgccgggcaccggtgctggcg
attcaacaggtgcccgaagaggatgtgtccaggtacggcatcatcaggccggctgctctg
gaggacagcgcttccctcttccgggtggaggacctggtggaaaagcccgccgtcggggag
gctccttcccgctacgcggtcatcggacgctatatcattacaccggagatcttcgatatt
attgaaacccttcctcccggtgccggaggggagatccagctgaccgacgccctgtgcagg
ctggccaagaggcggcccatttatgcttatctcttttccggggaaagatatgacgtaggg
gataaactcggttttctggaggccacggtgaagttcgccctggggcgcccggagctggga
agaagctttctcggatttctaagaaagctggtgcttgagaatcatgaggatggaggtgaa
atggatgcgggagagagtggaggccgttctcaacaaggtgcggccgttcctccagcgcga
tggcggtga

DBGET integrated database retrieval system