KEGG   Thermacetogenium phaeum: Tph_c06760Help
Entry
Tph_c06760        CDS       T02276                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase TpiA (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tph_c06760 (tpiA)
   01230 Biosynthesis of amino acids
    Tph_c06760 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c06760 (tpiA)
   00051 Fructose and mannose metabolism
    Tph_c06760 (tpiA)
   00562 Inositol phosphate metabolism
    Tph_c06760 (tpiA)
Enzymes [BR:tpz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tph_c06760 (tpiA)
Exosome [BR:tpz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tph_c06760 (tpiA)
  Exosomal proteins of bladder cancer cells
   Tph_c06760 (tpiA)
  Exosomal proteins of melanoma cells
   Tph_c06760 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707138..707899
Genome map
AA seq 253 aa AA seqDB search
MAGNWKMHKTPAEAGNFARLLRQRVAPGRGVEVIICPPFPALAAVATKLAGSEIGWGAQN
MHWEPEGAYTGEVSGPMLQAMGCRYVILGHSERRSYFRETDEEIRKKVGAALACGLRPIF
CLGENLATRRSGKAVDFCRRQFKDVLEGMEISVPDALVVAYEPVWAIGTGKTATPADATE
VIGALREEAARLFGREFSARLRFLYGGSVKPDSMPAFLEEEEIDGVLVGGASLDIEQFTA
IIDITADLRGNND
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcaactggaagatgcacaaaacgcccgccgaggcggggaacttcgccaggctg
ctgcggcaaagggttgcccccgggcgcggggtggaagtgatcatttgtccgccctttcct
gccctggcagctgtggccacgaagcttgccggcagcgagatcggctggggtgcccaaaac
atgcactgggagcccgagggggcttatacgggggaggtctccggaccgatgctgcaggcg
atgggctgccgctatgtgatcctggggcactcggagcgccgcagttatttccgggagacg
gacgaggagatcaggaaaaaggtgggggctgccctggcctgcggcttgcgtccgatcttt
tgcctgggtgaaaacctcgctacccgcaggtccggaaaggccgttgacttctgccgccgg
cagtttaaggatgtgcttgagggaatggagatcagtgtccccgatgccctcgtcgttgcc
tacgagccggtctgggcgatcgggaccggaaagacggcaacaccggcggatgccactgag
gtcatcggagccctgagggaggaggccgcccgtctcttcgggcgtgaattctcggcgagg
ctgcgcttcctgtacggcggcagcgtcaagcctgactccatgcctgccttcctggaagag
gaggaaattgacggggtgctggtcggtggggccagcctggatatcgaacagttcacggct
attatcgacattacagccgatctaagggggaacaatgattga

DBGET integrated database retrieval system