KEGG   Thermacetogenium phaeum: Tph_c06760Help
Entry
Tph_c06760        CDS       T02276                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00010  Glycolysis / Gluconeogenesis
tpz00051  Fructose and mannose metabolism
tpz00562  Inositol phosphate metabolism
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01120  Microbial metabolism in diverse environments
tpz01130  Biosynthesis of antibiotics
tpz01200  Carbon metabolism
tpz01230  Biosynthesis of amino acids
Module
tpz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tpz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c06760 (tpiA)
   00051 Fructose and mannose metabolism
    Tph_c06760 (tpiA)
   00562 Inositol phosphate metabolism
    Tph_c06760 (tpiA)
Enzymes [BR:tpz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tph_c06760 (tpiA)
Exosome [BR:tpz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tph_c06760 (tpiA)
  Exosomal proteins of bladder cancer cells
   Tph_c06760 (tpiA)
  Exosomal proteins of melanoma cells
   Tph_c06760 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFV10910
UniProt: K4LG12
Position
707138..707899
Genome map
AA seq 253 aa AA seqDB search
MAGNWKMHKTPAEAGNFARLLRQRVAPGRGVEVIICPPFPALAAVATKLAGSEIGWGAQN
MHWEPEGAYTGEVSGPMLQAMGCRYVILGHSERRSYFRETDEEIRKKVGAALACGLRPIF
CLGENLATRRSGKAVDFCRRQFKDVLEGMEISVPDALVVAYEPVWAIGTGKTATPADATE
VIGALREEAARLFGREFSARLRFLYGGSVKPDSMPAFLEEEEIDGVLVGGASLDIEQFTA
IIDITADLRGNND
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcaactggaagatgcacaaaacgcccgccgaggcggggaacttcgccaggctg
ctgcggcaaagggttgcccccgggcgcggggtggaagtgatcatttgtccgccctttcct
gccctggcagctgtggccacgaagcttgccggcagcgagatcggctggggtgcccaaaac
atgcactgggagcccgagggggcttatacgggggaggtctccggaccgatgctgcaggcg
atgggctgccgctatgtgatcctggggcactcggagcgccgcagttatttccgggagacg
gacgaggagatcaggaaaaaggtgggggctgccctggcctgcggcttgcgtccgatcttt
tgcctgggtgaaaacctcgctacccgcaggtccggaaaggccgttgacttctgccgccgg
cagtttaaggatgtgcttgagggaatggagatcagtgtccccgatgccctcgtcgttgcc
tacgagccggtctgggcgatcgggaccggaaagacggcaacaccggcggatgccactgag
gtcatcggagccctgagggaggaggccgcccgtctcttcgggcgtgaattctcggcgagg
ctgcgcttcctgtacggcggcagcgtcaagcctgactccatgcctgccttcctggaagag
gaggaaattgacggggtgctggtcggtggggccagcctggatatcgaacagttcacggct
attatcgacattacagccgatctaagggggaacaatgattga

DBGET integrated database retrieval system