KEGG   Thermacetogenium phaeum: Tph_c08220Help
Entry
Tph_c08220        CDS       T02276                                 

Gene name
aor3
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase Aor (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpz  Thermacetogenium phaeum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tph_c08220 (aor3)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tph_c08220 (aor3)
Enzymes [BR:tpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tph_c08220 (aor3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
846995..848800
Genome map
AA seq 601 aa AA seqDB search
MYGWVGRILRVNLSDGTIKKEPLDPIEARNYIGARGLGTRFWVKECDAEIDPLSEANNLI
FMTGPLTGTLATNAGRYNVICKAPLTGAMAASNSGGYWGPELKYAGYDGIIIEGKAEKPV
YLWINDDQVEIRSAEHLWGKDVNETTDTLRNETDFDARVACIGPAGENLVKFACVVNDYT
RAAGRSGVGAVMGSKNLKAVVVKGTGAVRVADPDAFMEALAKAREMVKNHPVTGQGLPAY
GTGILVNILDQSGGYPVNNFRDSGQFQFAEETSGETLAKTYLVRNKGCMGCGIGCGRITR
VPEGPYKGFGEGPEYEAQWSLGADCGVGDLAAILKANNYCNELGMDPITLGSTIACAFEL
YEIGAITEKETGIPLGFGNAAAMVELSRKAAYREGFGNDIAEGSYRLASKYGHPELSMSC
KKQEMAAYDPRVLQGMGLNYATNNRGGCHVRGYMTAPEILGIPEKLDNLATEGKAQWTKI
FQDLTAAVDSSGICLFLTFAIGAPELSEQLTAATGIDFTVEEIMKIGERIWNMERLFLLA
NGFTKADDTLPPRILKEPVKVGPCKGAVSKLDVMLPEYYEVRGWDAEGRPTPEKLQELGL
Q
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtacggctgggtaggtcggattctgcgtgtgaacttaagtgacggaaccattaaaaaa
gagcccttggacccgatagaggccaggaattatatcggtgcccggggattggggactcgc
ttctgggtcaaggaatgtgacgccgagatcgatccccttagtgaagcaaacaatttaatc
tttatgaccggtcctctgaccggtacactggcaactaatgccggtcgctacaatgttatc
tgcaaggcgccgctcaccggggctatggcggcatcaaactcaggaggctattgggggccc
gaactgaaatacgccggatatgacgggatcatcattgaaggcaaagctgagaagccggtt
tatctctggatcaacgacgatcaggtggagatccggagtgcagagcatctctggggcaaa
gacgtcaatgagacgaccgataccctgcgcaatgaaaccgacttcgatgcccgggtggcg
tgcatcgggccggcaggggagaacctggttaaattcgcctgcgtcgtcaacgactatacc
cgtgctgccgggcgttccggcgtcggagcggttatgggctccaaaaacctgaaagcggta
gtggtcaagggaactggagcggtcagggtagcggatcccgatgccttcatggaagcgctg
gcgaaggcgagagaaatggtcaagaaccatccggtgaccggtcaggggctgcctgcctat
ggcaccggaatactggtaaacatccttgatcaatccggtggttacccggtcaacaacttc
cgcgattccgggcagtttcagttcgccgaggaaaccagcggtgaaaccctggccaagacc
tatctggttcgcaacaagggctgcatgggctgcggcattggctgtgggcggatcacccgt
gtacccgaagggccttataagggattcggagagggccccgagtacgaagcccagtggtcg
ctgggggcagactgtggggttggtgacctggcggcgatcctcaaggccaacaactactgc
aacgagctggggatggatcctattacactgggtagcactattgcttgtgcttttgaactc
tacgaaattggagccattactgagaaggaaaccgggataccgttgggattcgggaatgcg
gcagcaatggttgagctttccagaaaagctgcttacagagaaggtttcggcaatgatata
gctgaaggttcttaccgtctggccagcaagtacgggcatccggaactgtcgatgagttgc
aagaaacaggaaatggccgcctacgacccgcgcgtcctgcaggggatgggcctcaactac
gccaccaacaaccgcggcggctgccatgtccgcggctatatgaccgctccggagatattg
ggaattccggagaagctggacaacctggcaaccgaagggaaggctcagtggacgaagatc
ttccaggatctcaccgcggccgtagactcttccgggatctgcctcttcctgacatttgcc
atcggagcaccggaactttccgaacaactcacagctgcaacagggattgactttaccgtt
gaagaaataatgaagatcggcgagaggatctggaacatggagcgactcttcctcctggcg
aacggctttaccaaagcggacgatacgctgccgccgcgcattttgaaggagccggtcaag
gtcggcccctgcaagggagcggtcagcaaactggatgtcatgcttccggagtactacgag
gtgcgcggatgggacgctgagggcaggccgaccccagagaagctacaagagctaggcctc
caataa

DBGET integrated database retrieval system