KEGG   Thermacetogenium phaeum: Tph_c09380Help
Entry
Tph_c09380        CDS       T02276                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tph_c09380 (pfkA)
   01230 Biosynthesis of amino acids
    Tph_c09380 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c09380 (pfkA)
   00030 Pentose phosphate pathway
    Tph_c09380 (pfkA)
   00051 Fructose and mannose metabolism
    Tph_c09380 (pfkA)
   00052 Galactose metabolism
    Tph_c09380 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Tph_c09380 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tph_c09380 (pfkA)
Enzymes [BR:tpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tph_c09380 (pfkA)
Protein phosphatases and associated proteins [BR:tpz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tph_c09380 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977947..978918
Genome map
AA seq 323 aa AA seqDB search
MKRQVNRIGMLTSGGDAPGMNAAIRAVVRKSIYHGLEVVGIKRGFDGLLKKEFVKLQLGS
VADIIHRGGTILHTARSEEFKTEEGQRKGVNNLRDGGIDGLVVIGGDGSFKGALALAKLG
VPVIGVPATIDNDVGGTDLTIGFDTAVNNVVDAINKIRDTATSHERIFIIEVMGRHAGHI
ALYAGLSGGAESILVPEIPVDIDEVIFKLQRGINRGKLHSIIIVAEGAASGLTIGEEIKK
RMGQETRVTILGHLQRGGTPTALDRMLASCMGAKAVDLLLEGESRKMVGIVNGQLVAVDI
EDALSRKRALNRELWELAAILAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcaggtgaatcgtatcggtatgcttaccagtgggggtgacgcccctgggatg
aatgccgcgatcagggctgtggtgcgaaaatcaatttaccacggactcgaggttgtcggc
atcaagaggggtttcgacggcctgttgaagaaagagtttgtgaaactccagttgggttct
gtggccgatatcatacaccgggggggcaccatcctgcataccgcccggagcgaggaattc
aagacggaagagggacagcggaagggggtcaataatctccgggacggggggatcgacggc
cttgttgtcatcggtggtgatggttctttcaaaggcgccctggctctggctaagctcgga
gtgccggtgatcggggtgcctgcaaccatcgataacgacgtcggtggtaccgatctgacc
atcggcttcgacaccgccgtcaacaacgttgttgatgccatcaacaagatccgggacacc
gccacttcccacgaacggatctttatcattgaggtcatggggcgccatgccgggcacata
gcgctttatgccgggctctccgggggggcagaatccattttggtgccggaaatacccgtc
gatatcgatgaggtgatctttaaactgcagcgtggcatcaaccgggggaagcttcacagc
atcatcatcgttgctgaaggtgctgccagcggcctgacgatcggggaagagatcaaaaag
agaatgggccaggaaacccgggttaccattctcgggcacctgcagcgaggggggacaccg
acagctctagacaggatgctggcgagctgtatgggagcaaaagcggtggatctgctgctg
gaaggggagagcagaaaaatggtgggaattgttaacggacagctggtggcggtggatatt
gaggatgcgttatcccggaaacgggcgctgaatcgcgaactctgggaactggcggctatt
cttgccatctaa

DBGET integrated database retrieval system