KEGG   Thermacetogenium phaeum: Tph_c09820Help
Entry
Tph_c09820        CDS       T02276                                 

Gene name
speB
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tpz  Thermacetogenium phaeum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tph_c09820 (speB)
Enzymes [BR:tpz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tph_c09820 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019264..1020184
Genome map
AA seq 306 aa AA seqDB search
MLNELCVREWQYLAAKGSYKEARLVLAGLPLELTVSFRPGTREGPQAIRAASQGLEEYSP
YLREDLNDHLIFDCGDLALPFGNLQVAFQRIEALCRVLLADAKIPVFLGGEHLITFPVVK
TLAEAYSGLKVLHFDAHADLCDDYLGEKYSHATVIRRVCEIVGAGNVYQFGIRSGTKEEF
EYGRSCTVFYPFEILPGLESCLQSLEGHPVYVTVDIDVIDPAYAPGTGTPEPGGVTPQEL
FRVFELLEGCRIVGCDFVELAPVYDRSGITSLLAAKLVREALLAFSRGVEGRNSPTGDRK
GGKSVD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgagctctgtgtgcgggaatggcaatatctggccgccaagggttcctataaa
gaggcccggctggtcctggcgggattgcctctggagctcacggtaagctttcgcccggga
acgcgggaagggccccaggcaataagagcggcctcccaggggctggaagagtacagcccc
tatttgcgggaagatttaaacgaccacttaatctttgattgcggggatctggccctgcct
ttcgggaatctccaggtagcttttcagaggattgaggccctctgcagggtgctgctggcc
gatgcaaaaataccggtatttctcgggggggaacacctgatcacctttccggtagtcaaa
acgctggcggaggcatatagcggcctcaaggttctgcatttcgatgcccatgccgatctg
tgcgacgactacctgggggaaaagtactcccacgccactgtgatcaggagggtctgtgag
atcgtcggagcaggcaatgtataccagttcgggatcagatcggggacgaaagaagagttt
gaatatggcagatcctgcaccgttttttatccctttgagatcttacccggtctggaatcc
tgcttacagtccttagaggggcaccctgtttatgtgacggttgatatcgacgtcattgac
cccgcttacgctccggggacgggaacgccggagcccggtggagtgacgcctcaagaactt
tttcgtgtttttgagcttttagagggctgccgtatcgtcggttgcgattttgtggaactt
gctcccgtctacgatcggagcgggattacctcgctcctcgccgccaaactggtgagggaa
gctctgctggctttttcccggggggttgaggggcggaattcgccgaccggggacagaaaa
ggcggcaaatctgttgattga

DBGET integrated database retrieval system