KEGG   Thermacetogenium phaeum: Tph_c10200Help
Entry
Tph_c10200        CDS       T02276                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tpz  Thermacetogenium phaeum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tpz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052619..1053320
Genome map
AA seq 233 aa AA seqDB search
MFHQKTAAEIVAVGRQLVSKGLVSGTWGNISARIPGAGDFLITPSGVPYESLDAQDLVLL
DPEGKVKKGTLRPSTETPLHIAIYKKRPDVLAIVHTHSPYASVFAVNRRELPPVLEEQAQ
LLGGTVRVAPYAPPGSKELADGAVTALEGRSAVILANHGVVGVGRSLKDALLICQVVEKG
AQVFLLAQLSGKPHVLSERDVALLRRNFLEKYGQNPLSSACALKEQSRKDDDN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgttccatcaaaagacggcagcagagatcgttgcggttggtcgccagctagtgagtaaa
gggcttgtctcaggaacatgggggaatatcagtgcccgcattcccggagccggtgacttt
ctgattactccgagcggtgtgccctatgagagcctggatgctcaagacctggttctctta
gatccggagggtaaggtgaaaaagggtactctgcgcccctccaccgaaacccctttgcac
atcgccatctataaaaagcgcccagatgttctggcgatcgttcacacgcacagcccttat
gcatcagttttcgccgtcaaccgtagggaactgccgccggttctggaggaacaggcacag
cttctagggggaactgtacgagtggcgccctacgcgcctcccggaagcaaagaactggct
gatggagcggtgaccgccctggaggggcgatctgctgttattttggccaaccacggtgtg
gtgggggtagggcgttcactgaaagatgccctgctcatctgtcaggtggtggaaaaaggg
gcacaggtcttcctgctggcccagctctccggtaagccgcatgttctttcggaaagggat
gttgcgctgttgcgcagaaacttcctggagaaatacgggcagaatcctctatcctctgcc
tgtgccttaaaagagcaaagccgaaaggatgatgacaattga

DBGET integrated database retrieval system