KEGG   Thermacetogenium phaeum: Tph_c12300Help
Entry
Tph_c12300        CDS       T02276                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpz  Thermacetogenium phaeum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tpz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253665..1254267
Genome map
AA seq 200 aa AA seqDB search
MISFLRGRLLGSEENRLLIDVQGIGYEVTVPSSLLQRLPSLGQEVELYTHLYVREDSLQL
YGFLSPRDRAMFRILLGARGIGPRVALAILDIIPGNELVAVLTKGEVEVLERIPGVGKKT
AQRLFFELRNKLPSDLQKKKEQTKGNSPVVDEVTRALLALGYSNKEAESALEKVPDDRVS
TASCEELLRIALRELGRRKG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatctcctttttgcgagggcgtttgctggggagcgaggaaaaccgtcttcttatcgac
gttcagggtatcggttatgaggtaaccgttccttccagcctgcttcagaggctgccatct
ctcgggcaagaggtagagctctatacgcacctttatgtgcgtgaggattccctgcagctg
tacggatttctttctccccgggatcgggctatgttcaggattttgctgggagcccggggt
attgggccccgggtagccctggcgatacttgatataattcccggcaacgaactggttgcc
gttttaacaaagggagaagtagaggttctcgagcggataccaggggtgggaaagaagacc
gctcagcgcttgtttttcgagctgcgcaacaaacttccctccgaccttcaaaagaaaaag
gagcagacgaaagggaacagtcctgttgttgacgaggttacccgggcactcctcgcgctc
ggctacagcaataaggaggcagaatcggccctggaaaaggtccctgacgatcgggtgagt
actgcatcgtgtgaagagctgttgcggatcgcgctccgggaactgggtagaaggaagggg
taa

DBGET integrated database retrieval system