KEGG   Thermacetogenium phaeum: Tph_c12300Help
Entry
Tph_c12300        CDS       T02276                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpz  Thermacetogenium phaeum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tph_c12300 (ruvA)
Enzymes [BR:tpz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tph_c12300 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253665..1254267
Genome map
AA seq 200 aa AA seqDB search
MISFLRGRLLGSEENRLLIDVQGIGYEVTVPSSLLQRLPSLGQEVELYTHLYVREDSLQL
YGFLSPRDRAMFRILLGARGIGPRVALAILDIIPGNELVAVLTKGEVEVLERIPGVGKKT
AQRLFFELRNKLPSDLQKKKEQTKGNSPVVDEVTRALLALGYSNKEAESALEKVPDDRVS
TASCEELLRIALRELGRRKG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatctcctttttgcgagggcgtttgctggggagcgaggaaaaccgtcttcttatcgac
gttcagggtatcggttatgaggtaaccgttccttccagcctgcttcagaggctgccatct
ctcgggcaagaggtagagctctatacgcacctttatgtgcgtgaggattccctgcagctg
tacggatttctttctccccgggatcgggctatgttcaggattttgctgggagcccggggt
attgggccccgggtagccctggcgatacttgatataattcccggcaacgaactggttgcc
gttttaacaaagggagaagtagaggttctcgagcggataccaggggtgggaaagaagacc
gctcagcgcttgtttttcgagctgcgcaacaaacttccctccgaccttcaaaagaaaaag
gagcagacgaaagggaacagtcctgttgttgacgaggttacccgggcactcctcgcgctc
ggctacagcaataaggaggcagaatcggccctggaaaaggtccctgacgatcgggtgagt
actgcatcgtgtgaagagctgttgcggatcgcgctccgggaactgggtagaaggaagggg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system