KEGG   Thermacetogenium phaeum: Tph_c15300Help
Entry
Tph_c15300        CDS       T02276                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase HemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tpz  Thermacetogenium phaeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tpz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550050..1551027)
Genome map
AA seq 325 aa AA seqDB search
MYYPQIRLRRRRLSPAVRKMLKETRLAVEELIYPLFVRSGTGIREPVESMPGVFRLSPDL
LLEEVAAAREEGILAILLFGIPDTKDEAASGAYDEQGVVQDAVRRLKAHFPELIVITDVC
LCEYTSHGHCGVVRGKEIVNDETLPLLAQTALSHARAGADFVAPSDMMDGRVKAIREKLD
FNGFTNTGIISYAAKFASAFYGPFREAAGSAPSFGDRRSYQMNPANRREALEEVLQDLAE
GADMVMVKPALAYLDIIREVRERVLCPLVAYNVSGEYALVKAAAARGWIDEKQIVLEMLT
GIKRAGADLIITYYARDVARWLREG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgtattatcctcaaatcaggctgcgacgcaggcggctcagccctgctgtgcggaaaatg
cttaaggagacaaggctggctgttgaggaactgatctaccccctctttgtgcgatcaggc
accggtatccgggaaccggtggagtctatgccgggggtcttccggctctcgcctgatttg
ctcctggaagaggtggcggcggccagagaagaggggatcttagcgatcctgcttttcgga
atacccgacaccaaggatgaggcggcgagcggcgcttatgatgagcagggggtagtccag
gatgcggtacgccggttgaaggcgcattttcccgagctgattgtaatcaccgatgtttgc
ctttgcgaatacacgagccacgggcactgcggggtcgtcagagggaaggagattgtcaat
gacgagaccctccccttactggcccagacggccctttcccatgcgcgcgccggcgccgat
ttcgtggccccgtcggatatgatggacggcagggtcaaggcaatccgggaaaagctcgac
tttaacggcttcacaaataccgggattatttcctatgccgcaaaatttgcctcggccttc
tacggccccttcagggaggcggcgggatccgccccttcctttggcgaccgtcgttcctat
cagatgaaccctgccaacaggagagaagcgctggaggaggtattgcaggatctggcggaa
ggtgccgacatggtgatggtaaaaccggccctcgcctatctggacatcatcagagaggtc
cgggaacgggtgctctgccccctggttgcctataacgtcagcggggagtatgcccttgtc
aaggctgctgccgcccggggctggatcgatgagaaacagatagttctggaaatgcttacc
gggatcaagagggcgggagcggatctcattatcacctactacgccagggatgttgcccgc
tggctgcgggaagggtga

DBGET integrated database retrieval system