KEGG   Thermacetogenium phaeum: Tph_c15550Help
Entry
Tph_c15550        CDS       T02276                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tph_c15550 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tph_c15550 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tph_c15550 (thrC1)
Enzymes [BR:tpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tph_c15550 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1575583..1576647)
Genome map
AA seq 354 aa AA seqDB search
MSWKGVIEAYRSFLPVTENTPVVTLYEGNTALLPAPRLSERLQVHLYLKFEGQNPTGSFK
DRGMTMAVSKAVESGSKAVMCASTGNTSASAAAFAARAGIKCVVLVPNGYIALGKLAQAL
IHGAEVIAIEGNFDTALRLVRKVTGEHPLTLVNSLNPHRIEGQKTAAFEICDQLGFAPDY
LALPVGNAGNITAYWKGFREYASAGRVSGTPKMLGFQAAGAAPIVRGEVVTEPQTVATAI
RIGNPASWQKALEALKESQGRIETVTDEEIISAYQLVARTEGLFVEPASAAALAGVIKLA
GEGFFPPGSHVVCIMTGHGLKDPDTTLKTCSLKPAVVPPDKNRVLDVLEKLQVL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaagggtgttatcgaggcataccgctccttccttcccgttactgaaaatacc
cctgtggtaaccctttatgaagggaatacggctctgcttccggcgccgcgtctatcggaa
agattgcaggtacatctctatcttaaatttgaaggccagaaccctaccggttcctttaag
gaccgggggatgaccatggccgtaagcaaggccgtagagagtggcagcaaagctgttatg
tgtgcctcaacagggaatacatcggcttcggcagcagcttttgccgcccgtgccgggatc
aagtgcgtagtcctcgtacccaacgggtacatcgcgctcggcaaacttgctcaggctttg
attcacggggcggaggtaatcgccattgaaggcaatttcgatactgccctccgattggtg
cggaaggttacaggggagcatcccctgacgctggttaattccctcaacccccaccggatt
gaggggcaaaagaccgctgctttcgagatctgcgaccaactcgggttcgcacctgattac
ctggccctgccagtgggaaacgccgggaatattacagcatactggaagggtttccgggag
tatgcctccgccggacgtgtctcgggcactccgaagatgctcggttttcaggcagcgggt
gcggctcctattgtcagaggagaagttgtaaccgaaccccagacggtggcaaccgccatt
cgtatcggaaacccggcaagctggcagaaggcgctggaggccttgaaggaatcgcagggg
cgcatagaaacggtcaccgatgaagagataatcagcgcctaccagcttgtcgcccgcaca
gaagggctttttgttgagccagcttctgccgctgctctggcgggggtcatcaagctggca
ggggagggctttttcccgccggggagccatgtggtctgcattatgaccggccacggctta
aaggatccggatacgacgctgaagacctgttctctgaagcctgcggttgttccccctgat
aagaaccgagttttagatgtgttggagaagctccaggtcctttaa

DBGET integrated database retrieval system