KEGG   Thermacetogenium phaeum: Tph_c15550Help
Entry
Tph_c15550        CDS       T02276                                 

Gene name
thrC1
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00260  Glycine, serine and threonine metabolism
tpz00750  Vitamin B6 metabolism
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01120  Microbial metabolism in diverse environments
tpz01230  Biosynthesis of amino acids
Module
tpz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tph_c15550 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tph_c15550 (thrC1)
Enzymes [BR:tpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tph_c15550 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: AFV11760
UniProt: K4LIG6
Position
complement(1575583..1576647)
Genome map
AA seq 354 aa AA seqDB search
MSWKGVIEAYRSFLPVTENTPVVTLYEGNTALLPAPRLSERLQVHLYLKFEGQNPTGSFK
DRGMTMAVSKAVESGSKAVMCASTGNTSASAAAFAARAGIKCVVLVPNGYIALGKLAQAL
IHGAEVIAIEGNFDTALRLVRKVTGEHPLTLVNSLNPHRIEGQKTAAFEICDQLGFAPDY
LALPVGNAGNITAYWKGFREYASAGRVSGTPKMLGFQAAGAAPIVRGEVVTEPQTVATAI
RIGNPASWQKALEALKESQGRIETVTDEEIISAYQLVARTEGLFVEPASAAALAGVIKLA
GEGFFPPGSHVVCIMTGHGLKDPDTTLKTCSLKPAVVPPDKNRVLDVLEKLQVL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaagggtgttatcgaggcataccgctccttccttcccgttactgaaaatacc
cctgtggtaaccctttatgaagggaatacggctctgcttccggcgccgcgtctatcggaa
agattgcaggtacatctctatcttaaatttgaaggccagaaccctaccggttcctttaag
gaccgggggatgaccatggccgtaagcaaggccgtagagagtggcagcaaagctgttatg
tgtgcctcaacagggaatacatcggcttcggcagcagcttttgccgcccgtgccgggatc
aagtgcgtagtcctcgtacccaacgggtacatcgcgctcggcaaacttgctcaggctttg
attcacggggcggaggtaatcgccattgaaggcaatttcgatactgccctccgattggtg
cggaaggttacaggggagcatcccctgacgctggttaattccctcaacccccaccggatt
gaggggcaaaagaccgctgctttcgagatctgcgaccaactcgggttcgcacctgattac
ctggccctgccagtgggaaacgccgggaatattacagcatactggaagggtttccgggag
tatgcctccgccggacgtgtctcgggcactccgaagatgctcggttttcaggcagcgggt
gcggctcctattgtcagaggagaagttgtaaccgaaccccagacggtggcaaccgccatt
cgtatcggaaacccggcaagctggcagaaggcgctggaggccttgaaggaatcgcagggg
cgcatagaaacggtcaccgatgaagagataatcagcgcctaccagcttgtcgcccgcaca
gaagggctttttgttgagccagcttctgccgctgctctggcgggggtcatcaagctggca
ggggagggctttttcccgccggggagccatgtggtctgcattatgaccggccacggctta
aaggatccggatacgacgctgaagacctgttctctgaagcctgcggttgttccccctgat
aagaaccgagttttagatgtgttggagaagctccaggtcctttaa

DBGET integrated database retrieval system