KEGG   Thermacetogenium phaeum: Tph_c17030Help
Entry
Tph_c17030        CDS       T02276                                 

Definition
peptidase ArgE/DapE family
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tpz  Thermacetogenium phaeum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tpz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1724306..1725637)
Genome map
AA seq 443 aa AA seqDB search
MKGSWCTMNCSRWPENWENNGIGRSTVSQGELTMNLQEIMRTAESFQSEIVNFLLEFCAI
PAVNPSFGGTGEFKRAVWLADYLNNQGIPVEIKEVPDEAVPEGRRLNLIAYISGREASAP
TLWLVAHLDTVAPGDKSSWASDPFTPVVKGERIYGRGVEDNGQAVACITFAVKMLKQLGL
VPERKVGLLFVSDEEAGSDKGLKHLVREGLFKPGDEALVPDSGTPDGGFLEIAEKSILWC
KFNVQGKECHASNPLAGINAGWIGSLLAVDMIKFLRGKYCHRDALFNPPFSTFELTQKFG
NVGSPNVIPGEDVFVVDFRVLPSIGLAEIIEDIERLLSKYEYEYGVRIKYETLQRLDAPK
PTPVAAPIVKKLSGILKEFGVSSRIGGIGGGTCAAFLREAGIPAVVWSTIEETAHQPNEY
VVIDNLVKDTAIMLALMMAQNGA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggtcgtggtgcaccatgaactgctcccgttggccagagaattgggaaaataac
ggtattgggagaagtaccgtttcgcagggagagttgaccatgaatctacaggaaataatg
aggacggcggaaagttttcaaagtgaaatagttaatttccttctggaattctgtgcgata
cctgcagttaacccctctttcggggggacaggggagttcaaaagagcggtctggctggcg
gattatctcaataaccagggaatacctgtggaaatcaaagaggtgcccgatgaagcggtc
cccgagggaaggcgcctcaatctcatcgcgtacatttccggccgggaagcttcagcgcca
accttatggttggtggcgcacctggatacggttgcccccggagataaaagcagctgggca
agcgacccttttacacccgttgtcaagggagagcggatatacggacgtggtgtagaagac
aacgggcaggcggttgcctgtatcacctttgcagtcaaaatgcttaaacagctcggcttg
gtgccggaaagaaaggtagggcttctgttcgtcagcgatgaggaggccggcagtgataag
ggattaaagcacctggttcgggaaggccttttcaagcccggggatgaagccctggtcccg
gattccggcacccccgatggagggtttttggaaatagcggaaaagtcgatcctgtggtgc
aagtttaatgtccaagggaaagagtgccatgcttccaacccactggcgggaatcaatgcc
gggtggatcggctctttactggcggttgatatgatcaagttccttcgaggtaaatactgt
caccgggatgctctttttaatcctcctttttcgacttttgaactcacccaaaagttcggt
aatgtgggaagcccgaatgttattcccggcgaggacgtctttgtagtggatttcagggtc
ttgccatccatcggccttgccgaaataatcgaggatatcgaaagacttttgagtaaatat
gaatacgagtatggtgtgaggatcaaatacgaaactctccaaaggctggatgcgccaaaa
cccacaccggttgctgcacctatagtcaagaagctgtccggcatcttaaaggagtttggg
gtgtcttccaggataggaggaatcgggggtggcacctgtgccgccttcctgcgagaggca
ggtatccccgccgtggtgtggtctactattgaagaaactgcgcatcaaccgaacgaatat
gtggtcatagataacctggttaaggatacggcgatcatgctggcgttgatgatggcacag
aatggtgcataa

DBGET integrated database retrieval system