KEGG   Thermacetogenium phaeum: Tph_c17030Help
Entry
Tph_c17030        CDS       T02276                                 

Definition
peptidase ArgE/DapE family
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tpz  Thermacetogenium phaeum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tph_c17030
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tph_c17030
Enzymes [BR:tpz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tph_c17030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1724306..1725637)
Genome map
AA seq 443 aa AA seqDB search
MKGSWCTMNCSRWPENWENNGIGRSTVSQGELTMNLQEIMRTAESFQSEIVNFLLEFCAI
PAVNPSFGGTGEFKRAVWLADYLNNQGIPVEIKEVPDEAVPEGRRLNLIAYISGREASAP
TLWLVAHLDTVAPGDKSSWASDPFTPVVKGERIYGRGVEDNGQAVACITFAVKMLKQLGL
VPERKVGLLFVSDEEAGSDKGLKHLVREGLFKPGDEALVPDSGTPDGGFLEIAEKSILWC
KFNVQGKECHASNPLAGINAGWIGSLLAVDMIKFLRGKYCHRDALFNPPFSTFELTQKFG
NVGSPNVIPGEDVFVVDFRVLPSIGLAEIIEDIERLLSKYEYEYGVRIKYETLQRLDAPK
PTPVAAPIVKKLSGILKEFGVSSRIGGIGGGTCAAFLREAGIPAVVWSTIEETAHQPNEY
VVIDNLVKDTAIMLALMMAQNGA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggtcgtggtgcaccatgaactgctcccgttggccagagaattgggaaaataac
ggtattgggagaagtaccgtttcgcagggagagttgaccatgaatctacaggaaataatg
aggacggcggaaagttttcaaagtgaaatagttaatttccttctggaattctgtgcgata
cctgcagttaacccctctttcggggggacaggggagttcaaaagagcggtctggctggcg
gattatctcaataaccagggaatacctgtggaaatcaaagaggtgcccgatgaagcggtc
cccgagggaaggcgcctcaatctcatcgcgtacatttccggccgggaagcttcagcgcca
accttatggttggtggcgcacctggatacggttgcccccggagataaaagcagctgggca
agcgacccttttacacccgttgtcaagggagagcggatatacggacgtggtgtagaagac
aacgggcaggcggttgcctgtatcacctttgcagtcaaaatgcttaaacagctcggcttg
gtgccggaaagaaaggtagggcttctgttcgtcagcgatgaggaggccggcagtgataag
ggattaaagcacctggttcgggaaggccttttcaagcccggggatgaagccctggtcccg
gattccggcacccccgatggagggtttttggaaatagcggaaaagtcgatcctgtggtgc
aagtttaatgtccaagggaaagagtgccatgcttccaacccactggcgggaatcaatgcc
gggtggatcggctctttactggcggttgatatgatcaagttccttcgaggtaaatactgt
caccgggatgctctttttaatcctcctttttcgacttttgaactcacccaaaagttcggt
aatgtgggaagcccgaatgttattcccggcgaggacgtctttgtagtggatttcagggtc
ttgccatccatcggccttgccgaaataatcgaggatatcgaaagacttttgagtaaatat
gaatacgagtatggtgtgaggatcaaatacgaaactctccaaaggctggatgcgccaaaa
cccacaccggttgctgcacctatagtcaagaagctgtccggcatcttaaaggagtttggg
gtgtcttccaggataggaggaatcgggggtggcacctgtgccgccttcctgcgagaggca
ggtatccccgccgtggtgtggtctactattgaagaaactgcgcatcaaccgaacgaatat
gtggtcatagataacctggttaaggatacggcgatcatgctggcgttgatgatggcacag
aatggtgcataa

DBGET integrated database retrieval system