KEGG   Thermacetogenium phaeum: Tph_c17340Help
Entry
Tph_c17340        CDS       T02276                                 

Gene name
bchI1
Definition
magnesium chelatase 38 kDa subunit BchI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tpz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1755765..1756988
Genome map
AA seq 407 aa AA seqDB search
MKNYLQLTRHTGNNALFLAVEMSLVSTLQGRPLHIHAEGLRGTGKTTIMRSVTQILPKIT
RIKGCLYNCEPERPHCPQHKNMTPEEIAALGTEQIPVPFLEISHSAKIGTVAGTIDLAKL
TNPSRPEAALLPGIIPQAHRGIVFVDEINRLADTSPEITDVLLDAMGTKPGRVQIEETGL
PVVEVPVAVSVWAASNPDEEPGPLAEIRRQLSDRFDLVIPMGRPTTPEEVVDILTTEEAK
NDRELSEQERSQLEQLRKNLENIALHSDLTMPDYLTTFLANLYINFNIESLRALEAIRQA
ALLHCALRKRSQVMISDIMAVLPLALYHRVSPATLTEIMNTVNNRMVGNEKEKENGKRSA
QGRQLPPIFHNKKGDKRQMSEDSPPEKARLLRDLPENGIIRKESERF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactacctccagttgacccgtcacacagggaacaatgctctcttcctggccgta
gaaatgtcccttgtctccaccctgcagggaagacccctgcacattcacgcagaagggctg
cgcggcacgggaaagaccactatcatgcgctcggttacacagatcctcccgaagatcacc
cgcatcaaggggtgtctctacaactgcgagccagagcgaccccactgcccgcagcacaaa
aacatgacgccggaagagatcgccgccctgggcacagaacagattcccgttccctttttg
gaaatctcccattccgccaagatcggtacggtcgccgggactatcgacctggccaagctc
accaatccctcccgaccggaggcggccctcctgcccggcatcatccctcaggcgcacagg
gggatagtcttcgtcgacgaaataaaccgcctggcagacacctcgccggaaataacggac
gttctcctcgatgccatgggcaccaagccagggcgcgtccagatagaggaaacgggcctt
cccgtcgtcgaggttcccgttgcggtttcggtttgggcggcatcaaaccccgatgaagag
ccggggcctttggcggagatccgccggcagctgtccgaccgcttcgatctggtcatcccc
atgggcaggccaaccacccctgaggaagtggtggatattctgacgacggaggaagccaag
aacgacagagagctttccgaacaggagcgcagccagctggaacagctgcgaaaaaacctg
gagaacatagccctgcacagcgatttgacgatgcccgattaccttacgacgtttctggcc
aacctctacatcaacttcaacatcgaaagcctccgggcgctggaagcgatccggcaggcc
gctctgttgcactgcgctttgaggaagcgcagccaggtcatgatcagcgacatcatggcg
gtacttccccttgccctttaccaccgggtcagcccggccacacttacggaaatcatgaat
accgtcaacaaccgcatggtcggcaatgagaaggagaaggagaacggcaaaagaagcgca
cagggacgccagctgccccctatttttcacaacaaaaagggagataagcggcagatgagc
gaagattctcctccggagaaagcgcgccttttgcgcgacctgccggagaacggaatcata
agaaaggaatcggaacgcttctaa

DBGET integrated database retrieval system